CAZyme Information: MGYG000001313_03031

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_03031
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001313_20|CGC3	28829.23	7.1137

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 103593; End: 104363 Strand: +

Full Sequence      

MIPKVIHYCWFGRNPLPPFAVKCIESWKKFLPGYEIKEWNEDNFDVNIIPYTQEAYEARK
YAFVSDYARFYILYHHGGIYFDTDVEVIKSIDDIIERGAFMGCENEAKPGATALAVAPGL
GLGCNPGLGLGCNPGLGLYAEILGLYAGLHFLRSNGGLNLKTVVEYTTELLSAKGLKNVN
EMQCVADVWIYPKEYFCPVNYQTNEMNITDNTRSIHHYAASWHGTRQILFKLVSKIVGKD
VAHKISAIVKSFNLIK

Enzyme Prediction     

No EC number prediction in MGYG000001313_03031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	22	96	4.1e-26	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.37e-22	1	119	81	203	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	7.88e-21	21	95	5	87	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	3.90e-12	1	96	45	145	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	8.41e-04	51	104	160	219	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
NF033479	Efa1_rel_toxin	0.002	35	94	458	523	LifA/Efa1-related large cytotoxin. Members of this family are large and almost certainly multifunctional proteins found in various pathogens from genus Chlamydia, about 3000 amino acids in size and related to lymphostatin (Efa1/LifA) from enteropathogenic Escherichia coli. Roles have been suggested for Efa1 (EHEC factor for adherence) in adhesion, so some members have been annotated as adherence proteins rather than cytotoxins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49668.1	7.45e-183	1	256	1	256
QRQ47479.1	4.19e-122	1	239	1	231
QUT46666.1	1.21e-120	1	239	1	247
ALA75301.1	3.89e-106	1	222	1	215
QJR59783.1	3.89e-106	1	222	1	215

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQW4	1.48e-08	1	100	1	106	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q10323	4.75e-07	2	101	57	159	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
O14084	1.41e-06	2	101	64	169	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_03031.