CAZyme Information: MGYG000001313_01863

Basic Information

• Species: Bacteroides eggerthii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides eggerthii
• CAZyme ID: MGYG000001313_01863
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
698	MGYG000001313_19|CGC1	79036.94	6.773

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001313	4157999	Isolate	not provided	not provided

• Gene Location: Start: 72711; End: 74807 Strand: +

Full Sequence      

MRKTILFLFVVASVLNNLMAQRNGLVDMGQSKFAKMTNTQLGAVKWTGGFWGERFNVFSR
HSLQGMWNTWKNPDVSHGFRNFEIAAGECEGTHWGPPFHDGDMYKWLEGVAAVYAVNHDP
ELDELMDYFIARVVKAQRADGYIHTPVIIDEKNKGIDTHAVANKQTVIGTKVGAENEKGA
FANRLNFETYNLGHLMMAGIIHQRATGKNTLFDVAVKATDFLCHFYETASAELARNAICP
SHYMGVVEMYRATGNTRYLELSQNLINIRGMVENGTDDNQDRIPFREQYNAMGHAVRSNY
LYAGVADVYAETGEEQLMKNLTSIWSDIVNRKMYVTGACGALYDGTSPDGTFYEPDSIQK
VHQSYGRPYQLPNSTAHNETCANIGNMLFNWRMLEITGDAKYAEIVETALYNSVLSGISL
DGLKYFYTNPLRISADLPYTLRWPKVRTEYISCFCCPPNTLRTVCQAQNYAYTLADKAVY
CNLYGSNTLQTELEGLGKIALAQHTDYPWEGSVRLVVESLPRASRKTAFSIYFRMPEWCD
KATLTVNGQAVAGNWKRNEYAHVNRIWKEGDIVEWVMDMSVRLLEAHPLAEEIRNQVVVK
RGPIVYCLESMDIDGGKRIDDVQIPTNIKFTPRKMQIAGSDVMVLEGIASLNEAESWEGM
LYREVNPTQKPVHIRLIPYYAWGNRGKSEMTVWMPVKR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	44	607	8.3e-186	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	43	607	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.41e-127	48	694	20	585	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ48826.1	0.0	1	698	1	698
QUT45350.1	0.0	1	698	1	698
QEW37287.1	0.0	1	698	1	698
QUT58578.1	0.0	1	698	1	698
QQY43428.1	0.0	1	698	1	698

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	0.0	5	698	6	698	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	9.60e-126	50	697	22	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.73e-121	50	697	22	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	2.02e-103	43	696	14	625	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	2.78e-87	76	692	51	654	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.21e-86	76	692	51	654	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999210	0.000149	0.000145	0.000134	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001313_01863.