CAZyme Information: MGYG000001312_00083

Basic Information

• Species: Helicobacter_D pullorum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D pullorum
• CAZyme ID: MGYG000001312_00083
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		43254.62	9.1929

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001312	1919109	Isolate	not provided	not provided

• Gene Location: Start: 7351; End: 8484 Strand: -

Full Sequence      

MNKPIKIFISALEYSANIHLSYLIQTLQKQYGECHFYGIFDSKILGFSSNFSPNEFRIMG
FSGVLKLIPRFFKIKKELIVLAKQCDIAIFMDSSSFNIPLLKALSGDLNKPYLVYYILPQ
VWAWKAYRAKILAQICDELWGILPFESAYYPKEANIAYVGHPLLDEIPFSREGRVDTGII
AFMPGSRISEIKALFPIFKSLAKKLKALQKQPLLIAPKHFENCDLSKIYGNLEDFSIVYD
TYEGLAKCEFAFVCSGTATLESTLLGIPTILAYKARKLDYWIAKSLVKLNYIGLANIFLE
FFYFGSPKDNKTPQNFPIHPEFLQEEVNPNTLFWAMQNYDYSKFFAQKKILLEYLKNGSA
KNCVQKIENFAKNMSKN

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	341	2.7e-87	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	2.47e-150	6	369	3	346	lipid-A-disaccharide synthase.
COG0763	LpxB	3.46e-96	4	372	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.28e-84	7	330	1	329	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	3.58e-82	1	332	1	337	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK00025	lpxB	5.15e-69	4	337	1	336	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ06254.1	4.81e-274	1	377	1	377
AWI33989.1	3.86e-169	3	376	4	377
QOQ98371.1	2.10e-160	3	376	2	392
CAE09911.1	1.86e-94	6	367	2	344
VEG82125.1	1.86e-94	6	367	2	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.94e-24	3	336	5	341	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.63e-24	3	336	5	341	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q17WJ2	3.07e-92	7	367	4	353	Lipid-A-disaccharide synthase OS=Helicobacter acinonychis (strain Sheeba) OX=382638 GN=lpxB PE=3 SV=1
Q9ZKY2	4.92e-91	7	367	4	353	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=lpxB PE=3 SV=1
Q1CT05	9.84e-91	7	361	4	347	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain HPAG1) OX=357544 GN=lpxB PE=3 SV=1
B5Z7M7	7.87e-90	7	361	4	347	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1
B2USW3	1.57e-89	7	361	4	347	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001312_00083.