CAZyme Information: MGYG000001306_02508

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_02508
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374	MGYG000001306_56|CGC1	42517.49	4.4961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 26451; End: 27575 Strand: +

Full Sequence      

MKYKLLFFFITGMLLASCSKIEDEYVYDTGYAIDWSAAADSASSTLPERFWNEEGYFNYE
NDGNGTGFQYWPQAQAMDVIIDAYLRSGNTKYSDLFTPWYEGIKVKNGNSYWNNFYDDME
WIALTMVRLYETTQDEKYLNTAKELWGYIEGGWNEEYGGGGIAWKSDQRWSKNACSNGPA
ALLAMRLYSVTQDEVYKNWGIKIYAWLRENLFNKATGAVYDNLNGETGEIGSFSLSYNQG
TFLGAAHELYKVTGEANYLKDARKAAYFCISDAGMIDSGNNVLRDEGSGDGGFFKGIFMR
YFVKLIMEPDLDELYRKKFETFFNNNAEVLWRKGVNKLDILFSTNWTTPASGSTQLGAQT
SGCALIEARSLWGK

Enzyme Prediction     

No EC number prediction in MGYG000001306_02508.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	41	357	2.2e-88	0.8966480446927374

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	7.69e-50	54	363	18	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	2.69e-40	68	361	43	338	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
cd00249	AGE	0.006	120	226	243	353	AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid. Catalytic mechanism is believed to be via nucleotide elimination and readdition and is ATP modulated. AGE is structurally and mechanistically distinct from the other four types of epimerases. The AGE domain monomer is composed of an alpha(6)/alpha(6)-barrel, the structure of which is also found in glucoamylase and cellulase. The active form is a homodimer. The alignment also contains subtype III mannose 6-phosphate isomerases.
cd04791	LanC_SerThrkinase	0.008	122	266	91	231	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA30005.1	7.92e-187	13	374	13	374
BBK86488.1	7.92e-187	13	374	13	374
QUT65780.1	7.92e-187	13	374	13	374
QMI79910.1	7.92e-187	13	374	13	374
QBJ18505.1	7.92e-187	13	374	13	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	2.08e-85	34	371	53	388	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	6.79e-84	34	371	54	389	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	5.39e-83	34	371	54	389	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	4.56e-46	35	367	3	335	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	1.82e-40	40	346	8	317	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_02508.