CAZyme Information: MGYG000001306_02170

Basic Information

• Species: Phocaeicola coprocola
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola coprocola
• CAZyme ID: MGYG000001306_02170
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000001306_47|CGC1	72297.13	5.0561

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001306	4295617	Isolate	not provided	not provided

• Gene Location: Start: 35376; End: 37295 Strand: -

Full Sequence      

MKKNTIKVLLLGLAAGISACTTGSRQNMSQERNRYEFSNILNIALTPDSTVHRAGCFTDA
GSWMGFTIPQQDKWVNGFCGPFSIDNRIWFAQSIVEASLIGETTAMTPDSASYFPGEVYI
SSSSGTESISQRMNFINASTALLQIESNSGKGLCFTARQWNNNVHLEAERNIVTVRHSNG
EIVTLTFDSDITLTCDGKNYVAQTEPGCKKTDIAISFFASEKELPVSEQRIQALLNNPSQ
ELKANADRWNGYLQKILRNDMKPEYDRIAVKSAVTLISNWRTHREGLLHEGVIPSHAVGY
FVGFWAWDSWRFSAALASFAPELAKNNIRAMFDYQLPDGMIIDCIYTNSADNNARDSKPP
LVCWAVDEIFTHTQDTTFVKEMYPQLLAYYKWWYAKRDHNRNGICEFGSTDGTLEAAAWE
SGMDNAIRFDNTKMLKNADDAWSMDQESVDLNAYLAYECKLLKKFASLIGISFDGPDYSD
KIADYFFDEKIGWFCDRRLSDGSFIEEPGCEGYTPFWVQIASKKQMDKAITLLTDTTKFS
TYIPFPTAAADNPKCDPNGYWRGPIWLDQTYQAIRGLRNYGYGKLADQYTEQVFERCQGL
KEDAPIHENYGTHNGERLQAPHFSWSSSHLLMMYEDYGK

Enzyme Prediction     

No EC number prediction in MGYG000001306_02170.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	164	637	2.9e-112	0.6228070175438597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	8.25e-129	1	637	1	783	alpha-glucosidase; Provisional
COG3408	GDB1	8.63e-17	305	634	285	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	2.93e-12	292	638	119	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	5.70e-08	376	635	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	0.003	307	393	156	239	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADY37311.1	0.0	1	639	1	638
QUT89313.1	0.0	13	639	14	642
QJR61716.1	0.0	1	639	1	644
AII67042.1	0.0	1	639	1	644
AII61903.1	0.0	1	639	1	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.93e-73	216	637	229	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	9.90e-73	216	637	229	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.37e-72	216	637	229	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	4.91e-70	216	637	230	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	8.67e-37	216	410	555	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.56e-72	216	637	252	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.71e-16	290	631	83	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	3.02e-16	290	631	83	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P53008	5.63e-07	376	627	538	824	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
O43280	1.44e-06	289	638	160	551	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000001	0.000101	0.999939	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001306_02170.