CAZyme Information: MGYG000001292_01127

Basic Information

• Species: Bifidobacterium infantis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Bifidobacteriaceae; Bifidobacterium; Bifidobacterium infantis
• CAZyme ID: MGYG000001292_01127
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001292_1|CGC22	40843.6	5.2727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001292	2832748	Isolate	not provided	not provided

• Gene Location: Start: 1288982; End: 1290109 Strand: -

Full Sequence      

MGILDKNKSKHGLLHRRVGMTLTALVAAVSMAFAPAAMADMQGIDVSNWQCGIDIANTQA
DFVVVGTTWGTGQVYNNCLVSGVNTDANRMIAQAQESGKKFGLYHYAMGGNPEAEAQFFY
RNTSNYWRHGIVALDWEMDDNPAWGNWDWVRRFMNECERLSGGVRPLLYTGPVAGTIPQD
IRDRYGLWIAQYANMSPTGYQANPWMIGAYGEAMRQYSGTGVVNTWSPIDLNIFRGDAWQ
WDLYANPAGGSTPPATPAAPAQPNTPPADTNTGGISHVMQWSETIWGLAVAYNAWPLSAW
HTPSGDINRYYVGDVVTYGGGSTAAPASSTGVSKVLQWGDTVWEFATSHGYSVSQCSVPS
GNINVYYVGDTVTCR

Enzyme Prediction     

No EC number prediction in MGYG000001292_01127.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	44	224	6.7e-31	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06417	GH25_LysA-like	4.27e-57	41	241	1	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd00599	GH25_muramidase	1.82e-21	42	234	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	6.39e-18	44	226	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	6.14e-17	42	234	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
COG3757	Acm	2.27e-12	23	241	46	262	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEG41715.1	4.38e-294	1	375	1	375
BAJ68713.1	4.38e-294	1	375	1	375
ACJ52190.1	7.84e-293	1	375	40	414
SDO48238.1	4.16e-283	1	375	1	375
QSG86910.1	4.16e-283	1	375	1	375

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000391	0.998708	0.000203	0.000294	0.000207	0.000177

TMHMM  Annotations     

start	end
13	35