CAZyme Information: MGYG000001275_01152

Basic Information

• Species: CAG-485 sp900321585
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900321585
• CAZyme ID: MGYG000001275_01152
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000001275_16|CGC1	66899.21	4.5487

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001275	2994513	MAG	Italy	Europe

• Gene Location: Start: 14087; End: 15856 Strand: +

Full Sequence      

MKKFVTMAVAMLAVLSLTGSCSKDDSGVTPPDPDPGKEVPDTPGNEDVKPLTKVPFNKGL
NLSDWFNVSDIQYFKADTYTDKDFDNLKSLGIDALRLPLNFPVFMGAAPEYKFNDSFLTA
LDKAVDMALKRDMYVILDQHSYYGSRMFPEGYGEQLVSAGLRQLAERYKDRSDHLIIELF
NEPGGTYLKANWPEMQKRLITEIRAIDKNRILIVTGYGCMIDELMKLPEYDDTRLIHTFH
FYNPFIFTHQGANWDDNPLQNIGAVDFPYDATTMPAAPESFNGNAEYTEYYNSYPAQGTD
KYIGDLLMNVYSWASQHGKLLFCGEFGTLTSAPSESRARWYKTVCDYFAAYGISWTAWEY
RDTKTPNFGIFKGANIFESNLDVDLCDAMGLTVPESYRTGCPEVVIFDDEIPFWWQQGGK
WEGYEPKIDFMCKENPEGGSLNCIRWDVDDKWGGLVMTPWPVADFSRQHSAGANLEFSIR
ADREFDSLTVRFTQYKAGATWQWRNMVEICTSKGGNSDINFAADGQWHRVSIPLSKFYIH
GTQGDWKDAPGAGDEGFAWDCINHIEFVPEGNENLVGKTIYLDNIRIRK

Enzyme Prediction     

No EC number prediction in MGYG000001275_01152.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	78	361	1.1e-61	0.9795221843003413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.60e-35	77	358	22	266	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.47e-15	26	332	19	327	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK54809.1	6.59e-115	51	587	41	557
QIK60227.1	3.67e-114	51	587	41	557
AKQ46720.1	1.88e-81	53	584	36	561
QMU29656.1	8.39e-81	53	589	13	546
AHM60127.1	5.38e-79	53	587	37	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3RJY_A	1.27e-35	81	371	44	302	CrystalStructure of Hyperthermophilic Endo-beta-1,4-glucanase in complex with substrate [Fervidobacterium nodosum Rt17-B1]
3NCO_A	1.27e-35	81	371	44	302	Crystalstructure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1],3NCO_B Crystal structure of FnCel5A from F. nodosum Rt17-B1 [Fervidobacterium nodosum Rt17-B1]
3RJX_A	1.27e-35	81	371	44	302	CrystalStructure of Hyperthermophilic Endo-Beta-1,4-glucanase [Fervidobacterium nodosum Rt17-B1]
6KDD_A	1.36e-35	81	371	44	302	endoglucanase[Fervidobacterium pennivorans DSM 9078]
3AMC_A	5.29e-34	81	371	36	295	Crystalstructures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMC_B Crystal structures of Thermotoga maritima Cel5A, apo form and dimer/au [Thermotoga maritima MSB8],3AMD_A Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_B Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_C Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3AMD_D Crystal structures of Thermotoga maritima Cel5A, apo form and tetramer/au [Thermotoga maritima MSB8],3MMU_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_E Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_F Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_G Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMU_H Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_A Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_B Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_C Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima],3MMW_D Crystal structure of endoglucanase Cel5A from the hyperthermophilic Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DJ77	7.60e-34	54	361	2	316	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	7.60e-34	54	361	2	316	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	3.67e-33	54	361	2	316	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P14250	2.39e-28	57	378	311	647	Endoglucanase 3 OS=Fibrobacter succinogenes (strain ATCC 19169 / S85) OX=59374 GN=cel-3 PE=1 SV=2
P16169	5.05e-25	58	354	9	287	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000014	1.000061	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001275_01152.