CAZyme Information: MGYG000001266_02406

Basic Information

• Species: Atlantibacter hermannii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Atlantibacter; Atlantibacter hermannii
• CAZyme ID: MGYG000001266_02406
• CAZy Family: GT2
• CAZyme Description: putative glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252	MGYG000001266_15|CGC1	28397.57	9.9243

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001266	4363538	MAG	Italy	Europe

• Gene Location: Start: 10195; End: 10953 Strand: +

Full Sequence      

MRLSVITVAWKNLAGVEKTWRSLAYLAAAPDFDFEWIVVDGGSDDGTAAFLQNLQGQYQL
RYVSEKDRGIYDAMNKGIQLARGDYALFLNSGDVFHPDIPKFVRQLAALPPQKPAMVIGD
ALLDFGNGHKTRRSAKQGWYIYHSLPASHQAIFFPMEGLKRYPYDLRYKVSSDYALAAKM
YKAGYPFKRINGLVSEFSMGGISTSNNIELCQDAKNVQRTILRVPGFWAELSYWLRLRTT
GKTKAAYQKSGL

Enzyme Prediction     

No EC number prediction in MGYG000001266_02406.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	134	9.2e-18	0.7529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04009	wcaE	4.73e-160	1	250	1	248	colanic acid biosynthesis glycosyl transferase WcaE. This gene is one of the glycosyl transferases involved in the biosynthesis of colanic acid, an exopolysaccharide expressed in Enterobacteraceae species.
PRK10063	PRK10063	4.56e-158	1	250	1	248	colanic acid biosynthesis glycosyltransferase WcaE.
cd06433	GT_2_WfgS_like	8.24e-60	4	206	1	202	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.29e-18	20	123	13	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	3.82e-17	4	145	1	140	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDZ74231.1	2.07e-187	1	252	1	252
QPS93069.1	2.07e-187	1	252	1	252
QFH72161.1	4.54e-161	1	250	1	250
AYN29753.1	5.60e-139	1	250	1	250
ATF91940.1	3.23e-138	1	250	1	250

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71239	1.01e-123	1	249	1	247	Putative colanic acid biosynthesis glycosyl transferase WcaE OS=Escherichia coli (strain K12) OX=83333 GN=wcaE PE=4 SV=2
P9WMX8	8.20e-11	3	99	7	101	Uncharacterized glycosyltransferase MT1564 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1564 PE=3 SV=1
P9WMX9	8.20e-11	3	99	7	101	Uncharacterized glycosyltransferase Rv1514c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1514c PE=1 SV=1
A1KMV1	6.80e-10	33	174	33	175	PGL/p-HBAD biosynthesis glycosyltransferase BCG_2978 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) OX=410289 GN=BCG_2978 PE=3 SV=2
A5U6W5	6.80e-10	33	174	33	175	PGL/p-HBAD biosynthesis glycosyltransferase MRA_2984 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) OX=419947 GN=MRA_2984 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001266_02406.