CAZyme Information: MGYG000001262_01349

Basic Information

• Species: Sphingomonas ginsenosidimutans
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Sphingomonadales; Sphingomonadaceae; Sphingomonas; Sphingomonas ginsenosidimutans
• CAZyme ID: MGYG000001262_01349
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
178	MGYG000001262_41|CGC1	19432.03	9.3814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001262	3667136	MAG	Italy	Europe

• Gene Location: Start: 6807; End: 7343 Strand: +

Full Sequence      

MIDELIDAVIDREGGFVRHPADRGGATRFGITEAVARANGYAGDMRHFTRPAAQSIYRRA
YWLNPGFDRVAERSPRVAAELFDTGVNMGPAVATAFLQRALNALNRGGSDYPDVVLDGRI
GAQTLAALDRFLATRGVRAPTVLVKAIEALQGERYLTLAEQRPANEAFLYGWLANRIG

Enzyme Prediction     

No EC number prediction in MGYG000001262_01349.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	6	89	4.3e-27	0.9767441860465116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3926	ZliS	6.57e-37	4	176	7	171	Lysozyme family protein [General function prediction only].
cd13926	N-acetylmuramidase_GH108	1.56e-32	1	89	2	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam05838	Glyco_hydro_108	1.58e-31	6	89	1	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
pfam09374	PG_binding_3	4.92e-13	92	177	1	76	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNE32569.1	1.29e-99	1	178	1	178
QCB40880.1	7.25e-90	2	176	3	177
BCA62797.1	1.09e-89	2	176	15	189
QKR98729.1	2.50e-88	2	178	3	179
BCA59023.1	1.44e-87	2	178	3	179

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6V3Z_A	4.66e-66	3	177	23	197	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]
6V40_A	5.93e-59	3	177	21	195	ChainA, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_B Chain B, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_C Chain C, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi],6V40_D Chain D, PG_binding_3 domain-containing protein [Salmonella enterica subsp. enterica serovar Typhi]
2IS5_A	1.21e-20	3	129	7	119	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	1.24e-20	3	129	6	118	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]
7DNP_A	5.07e-11	9	135	13	129	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001262_01349.