CAZyme Information: MGYG000001261_02410

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_02410
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		30498.23	10.0524

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 8882; End: 9754 Strand: +

Full Sequence      

MPAVSSIRSVVESAIQRASSATGVDFTFLMGTAKRESGFNPAAKARTSSASGLFQFVDQT
WLSTLKKHGAKYGYARYADLISQGGDGRYRVDGDEARKAVLGLKTDPHAASLMAGELASD
HASYLRGRVGRDPTAGELYAAHFLGPSGSARLIQAATASPGASAAAMFPDAAQANRSIFY
KDGRAATVGEVYANLTKTGGATRVDMAPAQAPVVQADQGFMQYAGGRRLERIRQQEAMVD
LILRGSQDVGNPFSGASDSASMGGGQRLASSMFSAEMLRVLSDANDKIKR

Enzyme Prediction     

No EC number prediction in MGYG000001261_02410.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01464	SLT	1.43e-04	15	60	1	45	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00442	Lyz-like	5.19e-04	28	61	1	35	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.
cd13401	Slt70-like	0.001	13	72	8	66	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16893	LT_MltC_MltE	0.002	13	60	1	47	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PHA00368	PHA00368	0.003	11	161	11	171	internal virion protein D

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATC34522.1	9.27e-164	1	290	1	288
ADG11545.1	2.82e-161	1	290	1	291
AVQ03203.1	2.82e-161	1	290	1	291
AZS22127.1	2.84e-160	1	290	1	287
AZH13420.1	1.64e-159	1	290	1	287

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BKH_A	1.23e-21	2	192	89	256	ChainA, lytic transglycosylase [Pseudomonas phage phiKZ],3BKV_A Chain A, lytic transglycosylase [Pseudomonas phage phiKZ]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8SCY1	1.04e-24	1	192	1871	2040	Peptidoglycan hydrolase gp181 OS=Pseudomonas phage phiKZ OX=169683 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_02410.