CAZyme Information: MGYG000001261_02166

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_02166
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
448	MGYG000001261_133|CGC1	48288.91	6.9744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 9335; End: 10681 Strand: -

Full Sequence      

MPNARSSLIALSLAALLAAPVQAAPRTYLGVDISYANEMEDCGAVYRSGGKTVEPYAFFK
SAGANVARIRIWNDPDWTPYSNLKDVKRSIAKARKAGLQVLLDFHYSDDWADGDKQIAPK
AWAKLSTPDQAKALYAFTHDTLAELDREGLMPDLVQVGNETNGEIVSSLAKAKEPINWQR
NALLFNAGIKAVRDAGAASKIKPRVMLHIAQPENVEPWFAAAAKAGVTDFDLIGISYYSK
WSKRSMAQLGQTINRLRHLYAADVLVVETAYPFTNDGADSSPNLLGADSLIAGYPATPEG
QKKYLTDLTQLVYASGGVGVVYWEPAWLSTKCKTRWGAGSNWENAALFDFKGQALEGVQW
LTAPYVMPVDVTFRVPAHGEAARFIDGDFLGGIGPRPMTLENGAWIYRTRLMPGASVTAA
TATDAAAVGEAAAKTATVGKGVSVIPLE

Enzyme Prediction     

EC	3.2.1.89

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	29	359	2.9e-105	0.9883040935672515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	2.34e-132	28	359	1	331	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	1.80e-80	20	359	31	389	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
COG2730	BglC	0.010	60	198	83	230	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ03355.1	3.98e-285	3	448	5	453
ADG11713.1	3.98e-285	3	448	5	453
AYV47198.1	1.53e-246	12	447	19	453
BBF80114.1	2.02e-178	11	438	16	447
ADU13045.1	2.52e-174	28	423	33	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	5.30e-53	20	371	42	402	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	6.13e-53	30	355	27	382	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	4.58e-52	30	355	27	382	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	2.63e-39	27	358	3	326	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
4BF7_A	2.85e-36	6	355	4	340	Emericillanidulans endo-beta-1,4-galactanase [Aspergillus nidulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48841	2.20e-120	28	365	28	369	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
P48843	2.66e-59	29	363	8	348	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
Q65CX5	6.00e-52	30	355	52	407	Endo-beta-1,4-galactanase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=ganB PE=1 SV=1
O07013	1.03e-48	30	359	56	415	Endo-beta-1,4-galactanase OS=Bacillus subtilis (strain 168) OX=224308 GN=ganB PE=1 SV=1
P83692	1.44e-38	27	358	3	326	Arabinogalactan endo-beta-1,4-galactanase OS=Thermothelomyces thermophilus OX=78579 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998871	0.000227	0.000195	0.000191	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001261_02166.