CAZyme Information: MGYG000001261_00764

Basic Information

• Species: Caulobacter sp903900155
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales; Caulobacteraceae; Caulobacter; Caulobacter sp903900155
• CAZyme ID: MGYG000001261_00764
• CAZy Family: GT83
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525	MGYG000001261_32|CGC1	57360.74	9.6621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001261	5012197	MAG	Italy	Europe

• Gene Location: Start: 16006; End: 17583 Strand: +

Full Sequence      

MAIAHESSALSIESRAWRLTLIGVAVLTLVRLVALFSTPLELYPDEAQYWLWSRELAFGY
FSKPPMIAWLIWLTTHIGGDAEPWVRLSAALLHGAAALVIHRIAKNLYGGWAGLVAAAIY
SLMPGVVLSSGLMATDAPLLFFLSLTIWAYVALAVETAPRRYFIAAGMGVALGCAFLSKY
AAIYVLGSIVIHYAISKPARDRWCPAAAVLFVTAFVLTLAPNFAWNASHQFSTVKHTASN
ANWGAHTLFNFPELIEFVGSQFGVFGPVPFAALLGGAIWLGIRKRMTSPDLLLICFSAPP
LIIVAGEAFVSRANANWAGAAFVAGSVLAAGWLLRWNARRWMIGGLALQAVFAAFFIACM
VSPRVVDATGLSNGFKRVRGWDQTVQAIIERSREETALRGPLSAVAMDDRFVYNAAAYYG
RDYFGQPGAPPLRMWVHEAYAQNQAEAQTPLDASYGRRALIVSLEGGYRPEIEQDFKAHS
GLQIARVRLDKKRSRRIDLFIAEGFAPLPRDPITGLPPQPLHQAQ

Enzyme Prediction     

No EC number prediction in MGYG000001261_00764.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	15	368	5.2e-57	0.6685185185185185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	2.54e-55	15	525	16	533	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.00e-22	62	225	1	160	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	9.48e-06	111	191	112	194	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1287	Stt3	7.38e-04	100	363	129	380	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].
PRK13279	arnT	0.004	44	302	31	305	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCH30010.1	9.47e-56	4	422	8	416
QTR45726.1	3.42e-54	12	505	2	469
QPB22219.1	1.41e-25	17	421	387	794
BCT68390.1	1.79e-22	17	241	394	614
QPF82639.1	5.43e-22	13	388	5	371

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1MLH5	3.43e-54	28	422	14	396	Lipid A galacturonosyltransferase RgtD OS=Rhizobium leguminosarum bv. viciae (strain 3841) OX=216596 GN=rgtD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43
110	132
139	158
168	190
203	225
257	279
291	310
315	334
341	363