CAZyme Information: MGYG000001254_01044

Basic Information

• Species: TF01-11 sp900759665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp900759665
• CAZyme ID: MGYG000001254_01044
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
622	MGYG000001254_7|CGC2	72213.36	6.1827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001254	3113115	MAG	Austria	Europe

• Gene Location: Start: 72616; End: 74484 Strand: +

Full Sequence      

MKTSDMIGKLKKIKRNIPLIQIPCEIIWIARHHGMGAVSDLLFFPKPRALRKMTLPPMEE
NVLFSVVVPLYETNEVYLRELIEAVQAQEYKKWELCLVDASRKKRESISALCNEYTQKDS
RVRYISVPENKGISANTDYGIRQAKGEYIALCDHDDILLPKALYMMAAAIQESDAEVFYS
DEDHLNKRGKHIFPLYKPDWSRDLLYSQMYTCHAFCFKKTIYDQVGGFRSEMDGAQDYDL
MLRFSELTDNIRHIPYVLYSWRESETSTAANADAKPYAHVAGLKALNDHLKRRYGEYAEA
VETEYPFVYRARFHTLGDKPKVSIIMPMKDHWEMTKQCIDSISEKSTYENYEIILLDNRS
EEPETHQWFEKLQKENDRVTLVKADFEFNWSKLNNYGMKYASGDIFIFMNNDMKIISPDW
METLCENAVREDIGVVGPLLLYEDGTVQHAGIIVGMGGWADHVYKETKLSHTGTPYVSPM
VNRNVTAVTGACMAVSRKTIEEIGGFDERFIICGSDVELCIRAYAYGKNNLYTPYVRIYH
LESKSRDSYIPEVDFKMSYNCYTPFREMGDPFYNIQLDKKRTAPRESHSKPDFEEIKVQL
QRKRLDKATYDALRQQVDSVDE

Enzyme Prediction     

No EC number prediction in MGYG000001254_01044.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	65	196	7e-25	0.7588235294117647
GT27	323	561	4.4e-23	0.8203389830508474

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.75e-91	63	263	2	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.97e-37	324	542	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.80e-25	320	550	3	229	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	5.73e-25	65	222	1	159	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.52e-21	65	262	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGF59169.1	5.16e-204	58	585	565	1089
ANU74717.1	6.12e-191	60	585	6	528
QQQ92265.1	6.12e-191	60	585	6	528
ASU27522.1	6.12e-191	60	585	6	528
QJU15227.1	6.12e-191	60	585	6	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3BCV_A	6.04e-06	65	156	8	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	5.30e-109	58	581	362	892	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.11e-105	58	577	315	831	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
A0A0H2UR96	5.85e-12	63	177	4	115	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q58457	9.33e-12	60	243	6	193	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q68X33	2.30e-10	58	244	1	193	Uncharacterized glycosyltransferase RT0329 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=RT0329 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001254_01044.