CAZyme Information: MGYG000001254_00633

Basic Information

• Species: TF01-11 sp900759665
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp900759665
• CAZyme ID: MGYG000001254_00633
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	MGYG000001254_4|CGC1	86463.1	5.1261

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001254	3113115	MAG	Austria	Europe

• Gene Location: Start: 2565; End: 4826 Strand: +

Full Sequence      

MLEKFVKDHYQKSLKDCSNEEIYIALLELVKEQAKQKESHAGKKKVYYISAEFLIGKLLS
NNLINLGLFDTVKKELEENGKSIYEIEEIEPEPSLGNGGLGRLAACFLDSIATLGIPGDG
IGINYHLGLFKQVFEQNLQKEYPNPWIEKNSWLTKRDKSYTVEFRDHVVKASLYDIAVTG
YENRTNQLHLFDIDSVEEKITKDGISFDKEDIEHNLTLFLYPDDSDEKGQLLRIYQQYFM
VSAGAQLILEECEARGCNLHDLPDYAAIQINDTHPTMVILELIRLLLIRGICIEEAMEIV
AKTCAYTNHTILAEALEKWPIAYLQKVVPQLLPIIHILDNEAKKKYPDEAVAIIDKEDRV
HMAHIDMHYGYSINGVAYLHTEILKNSELKPFYEIYPEKFNNKTNGITFRRWLLHCNEEL
TSWIEGLIGNGFKKDATELEKLLQYQGDQKVLESLLQVKAEKKKKLKEYLLRTQGVEIDE
NSIYDIQVKRLHEYKRQQLNALYIIHKYLEIKSGIIPEKPITVIFGAKAAPAYVIAKDII
HLILCLQELINKDEQVNPYLRVVMVENYNVSKAAQLIPACDISEQISLASKEASGTGNMK
FMLNGALTLGTMDGANVEIADLVGKDNIYIFGEDSETVIDRYAKGSYVSRDHYEKDAALK
EVVDFIVGKEMMAVGDKEHLTRLYNELLNKDWFMTFPDFEDYIATREKAYHDYNDRMAWA
EKMLVNIAKAGFFSSDRTIEQYDREIWKTGTSK

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	76	748	2e-225	0.9940652818991098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0058	GlgP	0.0	10	750	21	749	Glucan phosphorylase [Carbohydrate transport and metabolism].
PRK14985	PRK14985	0.0	25	748	41	795	maltodextrin phosphorylase; Provisional
TIGR02093	P_ylase	0.0	6	749	5	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	1	748	3	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00343	Phosphorylase	0.0	94	748	19	660	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SOB70959.1	0.0	4	748	5	749
QUF80147.1	0.0	2	748	3	749
AEN95921.1	0.0	2	747	3	748
ABX42709.1	0.0	1	747	1	747
VCV23296.1	0.0	2	747	25	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	0.0	4	747	10	755	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2C4M_A	3.84e-174	37	748	53	787	Starchphosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_B Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_C Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae],2C4M_D Starch phosphorylase: structural studies explain oxyanion-dependent kinetic stability and regulatory control. [Corynebacterium callunae]
1Z8D_A	5.58e-167	44	753	81	832	ChainA, Glycogen phosphorylase, muscle form [Homo sapiens]
5OX0_A	1.61e-166	44	753	81	832	GlycogenPhosphorylase in complex with CK898 [Oryctolagus cuniculus]
2GJ4_A	2.61e-166	44	753	69	820	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	0.0	2	747	4	749	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
P39123	3.58e-175	12	747	22	792	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
Q3B7M9	1.82e-168	23	747	53	826	Glycogen phosphorylase, brain form OS=Bos taurus OX=9913 GN=PYGB PE=2 SV=3
P11217	3.89e-167	44	753	81	832	Glycogen phosphorylase, muscle form OS=Homo sapiens OX=9606 GN=PYGM PE=1 SV=6
Q5MIB6	2.23e-166	23	747	53	826	Glycogen phosphorylase, brain form OS=Ovis aries OX=9940 GN=PYGB PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001254_00633.