CAZyme Information: MGYG000001253_00939

Basic Information

• Species: Paramuribaculum sp001689535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Paramuribaculum; Paramuribaculum sp001689535
• CAZyme ID: MGYG000001253_00939
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	MGYG000001253_8|CGC2	94786.89	5.6374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001253	2271514	MAG	Austria	Europe

• Gene Location: Start: 51741; End: 54293 Strand: -

Full Sequence      

MKKTALLCLGIAAAMAMPASLSAQDTFDFDTQRGEKQEFNKVPGHKVDHKGLVINPTPQS
LERPNTGVLNTSGGFKVKDKQKAFSAKDLGFMAQSPAGLEVEIDFGPKIAAKNKVKPVSG
AYALSIGTKKVKINAFDERGAFYALQTLRQVLESPMAKAEGGLPMMEINDYPALPYRGVV
EGFYGTPWSHQVRKDIINYLGRNKMNNYIYGPKDDPYHSSPNWRLPYPPEEAANIADLVK
TANENRLDFYWAIHPGKDIRWNKEDYDSLVSKFNMMYDLGVRSFALFFDDISGKGTDSHM
QTKLLNDLTRDFVDAKGEVNNLFICPTDYSQLWAGPGENHQLAVYGRELNPKAEVFWTGA
AVCSDLTPETLEFIDTRIKRPALYWWNYPVTDYARNYLLQGPVYGLDTSLTNAQVAGIES
NPMEHGEASMLAFYGVGDWAWNPAAYNAIDNWERALVDRLPDAAAAYRTFAINSADTETG
YRRDESWETTTFPFNKYTPEQYDALKKELTAAANAEKQILASTSNPALVGEIKPWVAQLT
KVANRGLGALDLIKIYEGGDNAKFWKAYLANLMTEQDRKDFEAHKVGTMKLQPFYEKAMD
DMVLAFFNRISGQVPNVPRAIGSYPNLRTTLSKLMLDNDTTTYWTSSASQSAGDWVGVDL
GKVVPVDEVLIHQGRNSTDDVDYFDNVALEVSVDGRNWTALTDALPSTYILNWQGDPVDA
RFVRIARRDSKKSNWTSVRSFRVNPVTAKRVGLNVNSTDPEASLLAFDGNPMTSYRSTGE
TSFDKAKGATQAVLMLGEITSPVQLVEYDHAGKETARTTIANPYTTVDLNRRTSRMALTG
NIEMFEIVQK

Enzyme Prediction     

No EC number prediction in MGYG000001253_00939.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	177	471	1.3e-99	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.41e-148	177	470	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	1.84e-11	56	170	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.
pfam00754	F5_F8_type_C	6.12e-11	636	725	18	110	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
COG3525	Chb	6.57e-07	54	228	136	310	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd00057	FA58C	1.93e-05	641	725	34	126	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALB75783.1	0.0	17	848	19	850
BCI62100.1	0.0	20	848	22	852
BBL05673.1	0.0	11	850	9	846
ADV43394.1	0.0	13	848	12	847
AHF11939.1	0.0	12	848	12	852

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MI4_A	2.71e-145	54	698	16	679	BtGH84mutant with covalent modification by MA3 [Bacteroides thetaiotaomicron VPI-5482],5MI5_A BtGH84 mutant with covalent modification by MA3 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],5MI6_A BtGH84 mutant with covalent modification by MA3 in complex with Thiamet G [Bacteroides thetaiotaomicron VPI-5482],5MI7_A BtGH84 mutant with covalent modification by MA4 in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482]
2J47_A	7.72e-145	50	698	1	668	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
7K41_A	8.43e-145	50	698	4	671	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J4G_A	1.06e-144	54	698	4	667	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482],2J4G_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with n-butyl- thiazoline inhibitor [Bacteroides thetaiotaomicron VPI-5482]
2JIW_A	1.09e-144	54	698	5	668	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482],2JIW_B Bacteroides thetaiotaomicron GH84 O-GlcNAcase in complex with 2- Acetylamino-2-deoxy-1-epivalienamine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	7.78e-144	50	698	22	689	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	1.45e-77	122	730	133	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	7.01e-77	122	730	133	746	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	4.34e-49	137	782	149	845	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	6.85e-36	178	439	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000234	0.999051	0.000183	0.000181	0.000169	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001253_00939.