CAZyme Information: MGYG000001252_00813

Basic Information

• Species: Catenibacillus sp900557175
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Catenibacillus; Catenibacillus sp900557175
• CAZyme ID: MGYG000001252_00813
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	MGYG000001252_55|CGC1	89219.83	6.8156

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001252	2417693	MAG	Austria	Europe

• Gene Location: Start: 1658; End: 4093 Strand: +

Full Sequence      

MKHQELIDKMSLEEKAAFLSGKNVWQTRDFPGLNIPSVFMADGPHGIRRQAGAGDHLGLN
ASLEATCYPTAAAMANSWDTELGERIGQALGQEAASQNVNILLGPGLNIKRSPLCGRNFE
YFSEDPYLAGKMAAAYVRGIQSQGVYACPKHFAVNSQELRRMAMNSVLDERTLREIYLTG
FEIAVKEGNAKAMMTSYNEVNGIYANENKHLLVDILRNEWQFDGIVITDWGASNDHAKGV
KMRSNLEMPAAGLDSAREIVDAVREKRLTVEELDLCVDDLLDAVLKLSEASANAAESFNT
EAHHKLAQEAAAQSAVLLKNDNAILPLKKGTRVALIGDFAITPRYQGAGSSMVNPTKIES
VAERIAEVKLELAGINAGYERTGGINEAVKKEALALAKTADVVIYCFGLDELSESEGMDR
SHMRIPENQIELLQAIAGVNPNIVGVLSGGAAIEMPWENCLKAILHSYLSGQAGAGAVVD
ILTGQVNPSGKLAETYPMCHEDTPALKNFPSRQRTAEYREGIYVGYRYYDTAGVQVRYPF
GYGLSYTEFEYSHFKVSPNGVSFKLKNTGTYPGAEVVQMYVSMADARIFRPKKELKGFKK
VFLNPGEEKSVEIAFDDKTFRVWNVKTNRWETEGGIYQILIGASSADIRLSGEMTVEAAM
TVCPYDREKLPSYYSGKIQNVGDNEFADLLGQPIPSGSWSGNLTENDAICQMYYAKSRLA
RFIYRCLTAAQKRSEAKGKPDLNILFIYNMPFRGIAKMTGGMVSMEMVRGMVMAVNGHLL
KGVGKMIKGYFANIKANKSYERKLSEKQTGK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	254	7.2e-69	0.9537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.99e-90	33	649	102	758	beta-glucosidase BglX.
COG1472	BglX	5.64e-70	31	340	56	364	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.85e-59	315	526	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.36e-56	4	616	54	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.71e-33	33	232	64	257	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE98345.1	0.0	1	805	1	805
ADL34828.1	0.0	1	806	1	806
QQR02742.1	0.0	1	808	1	812
QRT31068.1	0.0	1	811	1	811
ANU50590.1	0.0	1	808	1	812

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.76e-218	4	662	6	674	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.87e-180	7	666	9	673	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.07e-129	2	656	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.62e-128	2	656	3	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.33e-110	4	657	7	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	9.64e-218	4	662	6	674	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.28e-178	10	648	12	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	1.30e-177	10	648	12	664	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	1.60e-133	4	657	47	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	5.76e-122	4	658	12	840	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001252_00813.