CAZyme Information: MGYG000001237_02067

Basic Information

• Species: UMGS1600 sp900553295
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; UMGS1600; UMGS1600 sp900553295
• CAZyme ID: MGYG000001237_02067
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MGYG000001237_180|CGC1	51824.34	5.9465

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001237	2708995	MAG	Austria	Europe

• Gene Location: Start: 160; End: 1554 Strand: -

Full Sequence      

MRYENGKVLDLKIAYVGGGSRGWAWGFMTDLTGDGQMEGTVRLYDIDRDAAEKNAIIGRK
LSEHPEAKAHWTYTVADSLQEAMNGADFVVISILPGTFDEMEADVHLPERLGVWQSVGDT
AGPGGLSRAMRTLPMLAEIGQAVKDYAPNAWVINYTNPMTTCMRTLYTVFPEIKAFGCCH
EVFGTQKLLCAMLEDQCGITGVTRQEIHTGVIGINHFTWLNSATYQGMDLFPMYRKFAEK
YHDSGFTKGMDDNWMNNSFACSHKVKFDLFLRYGLIAAAGDRHLVEFLPPWYLKDPETVR
EWGFGLTTVAWRKNDLKERLARRARLLSGEEELDMKGSGEEGHLLIKALLGLGEMVSNVN
IPNRGQISNLPLNAVVETNALFRRDSIAPIHAGSLPMGIDALVTRQVLNQEATVRAALTC
DRQLALNTLMNDPQMGHVSLQDGKKLLDDLLEAQRKFLPKEWFA

Enzyme Prediction     

No EC number prediction in MGYG000001237_02067.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	192	2.6e-52	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	1.15e-149	11	452	1	421	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.44e-105	11	463	4	440	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	1.05e-68	12	463	3	431	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	2.10e-51	12	189	1	177	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	2.83e-51	11	453	1	425	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA52691.1	3.82e-239	1	463	1	464
QTE72492.1	2.46e-237	1	463	1	463
QTE73479.1	2.46e-237	1	463	1	463
QUC66877.1	4.06e-236	1	463	1	463
QTE69428.1	2.40e-228	7	464	8	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	8.02e-154	10	453	5	438	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	9.96e-29	11	460	5	436	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	4.83e-28	11	460	8	439	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1U8X_X	1.22e-20	41	460	60	463	CrystalStructure Of Glva From Bacillus Subtilis, A Metal-requiring, Nad-dependent 6-phospho-alpha-glucosidase [Bacillus subtilis]
6DUX_A	8.04e-20	40	460	37	441	ChainA, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DUX_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_A Chain A, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae],6DVV_B Chain B, 6-phospho-alpha-glucosidase [Klebsiella pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	2.13e-206	1	458	1	458	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
A9KTB9	3.22e-201	1	462	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
D3T426	3.01e-169	1	462	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	1.92e-158	10	453	9	442	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	6.02e-43	12	460	3	430	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001237_02067.