CAZyme Information: MGYG000001209_00878

Basic Information

• Species: Porphyromonas uenonis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas uenonis_A
• CAZyme ID: MGYG000001209_00878
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000001209_13|CGC1	42434.88	7.4063

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001209	2042909	MAG	Austria	Europe

• Gene Location: Start: 29198; End: 30349 Strand: +

Full Sequence      

MKYLLIAGEASGDEHGARLIASLKAVDTEAAFAFIGGDKMAQQAGVAPLYHYREIAVMGF
TSVLRSMRKISYAAQLLREEMTSNPPDAVIPIDYGGFNLRYTLPMAHRHGVPVVYYIPPK
VWASRQRRIKQLRSYTDLCLTILPFEADYLSQRGVLARYVGNPSIQSVGELLASNAKLCD
TVRPYIALLPGSREAEIARNLPIMCQAIDLLPAPWRAVIAGAPSIDRAHYTPYINERIEL
VTNETLPLLAGASAALVTSGTATLETALIGTPQVVAYRLPAGRLARWAFDHLLPIRYFSL
VNLIAECPVVEELLGDKVTPRRLAQALSPLLEREGSAYQVQQAHYDEIRQRLDPSRVASQ
VAAETIYYALTTQWEPTRWTTDD

Enzyme Prediction     

No EC number prediction in MGYG000001209_00878.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	7.9e-98	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.84e-96	1	366	2	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.97e-93	1	366	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.83e-75	4	356	2	363	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.13e-68	4	366	9	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.12e-46	1	326	2	312	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12174.1	2.04e-238	1	375	1	375
SQH73726.1	7.29e-102	1	366	1	372
QUB42945.1	3.88e-100	1	362	1	364
ATS09476.1	2.12e-93	1	366	1	370
ATS02318.1	8.47e-93	1	366	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	3.93e-38	5	331	11	345	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	3.93e-38	5	331	11	345	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	9.09e-57	2	325	6	335	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	1.48e-55	4	331	13	350	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
B6J161	4.49e-55	4	362	7	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
A9KC41	4.49e-55	4	362	7	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J9H1	4.49e-55	4	362	7	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuK_Q154) OX=434924 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001209_00878.