CAZyme Information: MGYG000001208_02094

Basic Information

• Species: Enterococcus_C dispar
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_C; Enterococcus_C dispar
• CAZyme ID: MGYG000001208_02094
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000001208_18|CGC1	42203.87	7.4571

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001208	2570475	MAG	Austria	Europe

• Gene Location: Start: 9833; End: 10948 Strand: +

Full Sequence      

MKQKPLLLWGIAICLLASYVVILFRTIADNEHNIQINLYQKWRENYVITTKEGSFVDTGT
TTRSTLSEAQGYAMVITTLAAEKGFASESDFEALYAYYTQYQIGNGNHLMQWRQSQTKKG
WESDSLHNATDGDLDIAYSLIKASKLWPKSKHDYAAAANKLLADIKQYNYNADTNFLTVG
DWATVDQKASRILRPSDIMPAYFTEFYHFTHDSFWQGLNTRGIELLQILSKQVKTGLMPD
FAWFETNNTLTPAKKNQVNNQYDGDYSANACRIPLRLMKSNDPKVAPILDKMLAFFADQK
FVYAGYSLKGKALVDYQNQSFSAPVLAAAYKAEPYSGLVTSQKWVVEEPIHGKNYYDETL
KVLSVLEMYNK

Enzyme Prediction     

EC	3.2.1.132	3.2.1.4	3.2.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	366	9.7e-74	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	2.55e-21	39	366	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.14e-16	51	366	39	342	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	3.69e-11	38	360	27	344	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA86250.1	2.03e-224	1	371	1	371
CEN28757.1	8.73e-113	1	369	1	369
ATC61807.1	2.00e-111	13	369	13	369
QCQ14860.1	2.21e-111	1	371	1	372
QIW56350.1	2.84e-111	13	369	13	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	4.91e-36	39	368	66	402	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	1.18e-26	67	366	73	375	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	1.35e-26	67	366	79	381	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
1KWF_A	8.96e-19	26	366	15	350	ChainA, Endoglucanase A [Acetivibrio thermocellus]
1CEM_A	2.24e-18	26	366	15	350	ChainA, CELLULASE CELA (1,4-BETA-D-GLUCAN-GLUCANOHYDROLASE) [Acetivibrio thermocellus],1IS9_A Chain A, endoglucanase A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	9.75e-34	39	368	66	402	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	1.78e-24	29	366	81	431	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
A3DC29	4.05e-18	26	366	47	382	Endoglucanase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celA PE=1 SV=1
P37699	2.04e-13	24	362	49	364	Endoglucanase C OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCC PE=1 SV=2
P37701	2.08e-12	17	362	42	364	Endoglucanase 2 OS=Ruminiclostridium josui OX=1499 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.998727	0.001090	0.000124	0.000007	0.000003	0.000066

TMHMM  Annotations     

start	end
5	27