CAZyme Information: MGYG000001194_00577

Basic Information

• Species: QAMH01 sp003149935
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; QAMH01; QAMH01; QAMH01 sp003149935
• CAZyme ID: MGYG000001194_00577
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821		91690.3	4.8128

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001194	2060639	MAG	Austria	Europe

• Gene Location: Start: 24046; End: 26511 Strand: +

Full Sequence      

MASVTPQFAGYGESNLKFTNHDRSPYTGMIRMLSTGCIKGLALTDKSLAMCRGDLYCYLA
FELDEDSPRIALGAVFSCGGLELPVPVYPLEEVLGVESRRWVAVFPHKTDEDQRVTVIDR
ATGRQIYDYQFSYADMKWQSRLAYRIKKSLAMRMRDIDQLYWSTGILIELVDVFSASADE
QIMRLDFVFPYARLDDAIDTDFMLAQGSCSQVIVMEDGLGNDGKRHVSLSMRVACDDPGS
FVFAQDSREPGCQPGLLVVDAPMRAEEARRTRERMASADADPTYPHWLVRHRAQAFQLSA
QRATSRDWSVGVLMDIDRIDASALTQSLAALRDQSVSVRGLCLMGAGAKRAKTRMHSASQ
DYGLVEVVQDADEAIGLLGTDCLLVMDQHDILEPNALYELALCLRAEGDALLAYADDDQV
DRTLAVYRNPRLKPDIDIDALYAGNYIGSCALLRAGVFEELALSSIKTAEQLIYAAALEL
CVRQGAIAHVPRVLCHRRDQKSDLRMLEGDPELLAKHLHAQDVSAHITRGDAYNRVIYEP
SEPQKLVSIIIPTKDHAPMLEDCVNSILEMAGYDAFEIVLVENNSAQPETFAFYEELTKR
DARVKVATYEGTFNFSKIVNYGVSQSSGELVLILNNDTKAITDGFLDIMAGYFERPEVGV
VGPMLRYPDGLVQNAGIALMTSGCLGFMNQNRAPEYDRGYLGSLVHPREYSAVLGACLMV
RRSDFDAVGGFTEELAVTYNDVDFCWKLRERGLRCVFTPYAELYHLEFASRGRDRVNEQR
AIQTELEAGIMRQRWPRYFACGDPVYNPACSQVDPNFKLGR

Enzyme Prediction     

No EC number prediction in MGYG000001194_00577.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	548	727	5.7e-21	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	6.18e-35	549	767	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.87e-23	547	773	5	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	9.93e-18	545	802	54	301	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd04184	GT2_RfbC_Mx_like	4.62e-17	385	498	89	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd00761	Glyco_tranf_GTA_type	1.76e-16	549	757	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY61397.1	7.18e-106	49	808	7	790
QOY61387.1	3.40e-104	51	815	9	802
ACV56006.1	5.70e-104	85	819	90	829
ACV56016.1	9.73e-102	58	815	2	787
QIA33434.1	1.10e-100	43	819	1	828

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.05e-61	287	819	344	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.47e-49	254	821	246	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P9WMY2	2.21e-11	546	774	4	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	2.21e-11	546	774	4	244	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
A0QSC1	2.53e-07	547	765	84	281	Pre-mycofactocin glycosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mftF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001194_00577.