CAZyme Information: MGYG000001185_01068

Basic Information

• Species: CAG-269 sp900554565
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-269; CAG-269 sp900554565
• CAZyme ID: MGYG000001185_01068
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A/1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		44144.47	9.6488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001185	1357656	MAG	Austria	Europe

• Gene Location: Start: 8665; End: 9834 Strand: -

Full Sequence      

MPRRKKSKHLDSDREPKAITEMKREAKKEETKKNIKSKKKKVIAILIILVIIFFAINLGI
STHKWKTIVKDMAINQPSVVKDIQGNEIAKLGSEKKKKTISKIPDNLKNAYVAIEDERYY
KHHGVDIKRTASAIGSYVIHFGSSSFGGSTITQQLVKNLTSDSTDSITRKVKEWWKAWQA
ETCLSKEEILTLYLNSIYVGPSIYGVEAGAQYYFSKSAENLSIEECAFIAGINHSPNSYN
PFSDKDNSEKIKKRTKTVLNKMKELGYIEEKEYSAAIQNVENGLKFNQGAIASDTSIYSY
HTDALITNVTNDICNKYDINEEFASNYLSMAGLTIYSTQDSKIQTEMEKECEKKKYILAS
KNGTDTSQAAMVIIDHKTGNVLRMYRWTW

Enzyme Prediction     

No EC number prediction in MGYG000001185_01068.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	85	263	3.5e-60	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0744	MrcB	3.70e-75	75	385	53	344	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	3.43e-73	84	263	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	1.79e-59	76	344	47	298	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.25e-43	69	276	39	243	penicillin-binding protein 1a; Provisional
TIGR02071	PBP_1b	1.71e-40	88	384	136	421	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66566.1	3.17e-62	78	385	76	388
QPJ85883.1	1.95e-59	73	381	55	382
AEY67746.1	3.59e-59	72	385	71	389
ACL77170.1	3.82e-59	72	385	71	389
ABG87192.1	9.42e-59	73	381	67	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	5.43e-33	99	277	24	198	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.48e-32	99	277	24	198	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	2.85e-31	69	349	13	276	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	5.48e-31	76	349	19	313	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
5ZZK_A	4.89e-30	86	280	48	244	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0SRL7	1.88e-59	73	381	67	390	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q8XJ01	2.32e-59	73	381	67	390	Penicillin-binding protein 1A OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=pbpA PE=3 SV=1
Q0TNZ8	2.87e-59	73	381	67	390	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1
A7GHV1	2.86e-54	72	381	51	369	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	4.02e-54	72	381	51	369	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999988	0.000036	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
42	61