CAZyme Information: MGYG000001168_01631

Basic Information

• Species: CAG-1427 sp000436075
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427; CAG-1427 sp000436075
• CAZyme ID: MGYG000001168_01631
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
838	MGYG000001168_29|CGC1	93348.96	4.9239

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001168	1867940	MAG	Austria	Europe

• Gene Location: Start: 222716; End: 225232 Strand: -

Full Sequence      

MNVSFKTIRRSGDKVYILSEISGYDERLPVVLAASTESGARIPSDTFPYCDVADPLALRQ
VLSDGALANREMPFPPLHTKNSAGVRFFVIALPWLSCRRWELEFNAIDSSGNVIASCRKV
LDVRATSLKVMAPQRSGAVPSLIEDLDGRFIHDRIHVSFLRAFETGDKIRVSALLEMPYH
EASVVECDFLDKTGRRLDLKPAIVEDSVSQSPGYGALRRRYIELSFLVDADNPQICLCAT
DTASTVAPGFAMLGNRTLESLVDEFDEQTTSAALDPEYHEWFVKQHRADVPDLLEQVATR
FDYEPLFSIVCVLDDTPSHHVHDLMNSIALQSYGRWELILVDAGSSGSEAADLKDSLDSD
RVYVVETDQSLGINERFAAGMATVEGDFVVFMKPCDIMAPDALFECVRAINEYSDCDVLY
TDVDAFDADGVHFQPVFRPDFSPELLRSYNYLRDLVVVRSSLLSGLPNLPYAIMGAAGYD
LALRVTEKARRVCHVPRVLCHRRFATIDTSEGFKATQIEQEAGRKALVAHCQRMGINAEV
LNDHEPGHYRVRHVLAESPRVSVVLIFEGNAPLLRTCVRDLYEKIGYANFEIVVVSTAAF
AQETKACLAELAEDHDSLSVLEWDGPFNKAQIANFAVKNTQGEFLLFLNDDASILTDDAL
EQLLGYFQRPDVGVVGPKQLFIDGTVEHAGIVVGGSRVVTPLFRHMDAESQGYLDRAVVA
QNVSAVTGDCMMLRRSAYEEVGGFSEEFTLFYADVDFCLKVRNAGYYTVFTPHVLLSHLH
SVSRMRIRSKEISIRRRKEAALLQSAWPSIFVEGDAFYNPNLNPDSSYFAMKRGKPRG

Enzyme Prediction     

No EC number prediction in MGYG000001168_01631.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	563	742	1.2e-17	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	5.89e-54	305	503	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	3.04e-29	563	780	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.27e-22	559	798	3	240	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.39e-14	308	503	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13641	Glyco_tranf_2_3	4.57e-14	559	780	2	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV56006.1	2.97e-168	1	831	1	829
QOY61387.1	5.57e-129	86	831	58	809
ACV56016.1	3.07e-127	79	828	36	788
CBL21587.1	8.96e-124	277	833	254	814
QCU01344.1	8.96e-124	277	833	254	814

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	3.01e-78	277	833	292	842	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
P55465	2.33e-70	294	831	355	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
P9WMY2	4.33e-06	659	784	108	243	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	4.33e-06	659	784	108	243	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P26403	6.00e-06	611	781	47	211	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001168_01631.