CAZyme Information: MGYG000001164_00871

Basic Information

• Species: Prevotella lascolaii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella lascolaii
• CAZyme ID: MGYG000001164_00871
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
467	MGYG000001164_50|CGC1	53234.96	7.0763

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001164	3302780	MAG	Austria	Europe

• Gene Location: Start: 8713; End: 10116 Strand: +

Full Sequence      

MKKNLLFFLFYATATLLLWNCAPKSVASYSPIQITVPERPAGQTDVVGLTAPPLDTVRVG
FIGLGMRGPGAVERWTHIPGTKIVALCDIVKERAENARDIVTKSGRPAPDIYYGSEDAWK
KMCERDDIDLIYIATDWKHHAQMGVYAMEHGKHAAIEVPAAMTLEEIWKLINTSERTRKH
CIQLENCVYDFFELTTLNMAQHGVFGEILHVEGSYIHNLEDFWPYYWNNWRLDYNRKHRG
DVYATHGLGPACQLLDIHRGDRMKTLVAMDTKAVSGPKLVRKLQNEDGSDFRNGDHTMTF
IRTENGKTIHIQHDVMNPRPYSRMYQLTGTEGFANKYPVEQYCLRPEKSAATGIPDHEKL
DMHSAVSQEVKDMLMKKYKHPIHQELEETARKVGGHGGMDFIMDYRLVYCLHNGLPLDMD
VYDLAEWCCMADLTRLSIENGSAPVAVPDFTRGAWNKIKGYRHAFAK

Enzyme Prediction     

No EC number prediction in MGYG000001164_00871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	53	457	5.5e-167	0.9924812030075187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.41e-18	56	358	3	281	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.97e-11	57	182	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	1.70e-06	57	153	18	128	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND18351.1	5.46e-290	1	467	1	471
QJR69673.1	5.46e-290	1	467	1	471
AII65507.1	5.46e-290	1	467	1	471
QUT85769.1	5.46e-290	1	467	1	471
QJR74006.1	5.46e-290	1	467	1	471

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	3.93e-89	39	455	25	438	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	3.47e-67	57	459	21	435	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
3EC7_A	2.56e-09	56	215	23	176	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4H3V_A	1.96e-06	59	166	9	114	ChainA, Oxidoreductase domain protein [Kribbella flavida DSM 17836],4H3V_B Chain B, Oxidoreductase domain protein [Kribbella flavida DSM 17836]
1OFG_A	5.94e-06	36	208	10	179	ChainA, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KX96	4.44e-290	1	467	1	471	Glycosyl hydrolase family 109 protein 1 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0340 PE=3 SV=1
Q89ZX8	8.33e-271	22	467	22	467	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4243 PE=3 SV=1
Q5LGZ0	2.89e-268	16	467	12	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0853 PE=1 SV=1
P0C863	2.89e-268	16	467	12	464	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1
Q7MWF4	8.28e-262	22	467	23	468	Glycosyl hydrolase family 109 protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=PG_0664 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000112	0.117722	0.882036	0.000039	0.000051	0.000045

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001164_00871.