CAZyme Information: MGYG000001156_01353

Basic Information

• Species: SFHK01 sp004556395
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; SFHK01; SFHK01 sp004556395
• CAZyme ID: MGYG000001156_01353
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585	MGYG000001156_65|CGC1	66851.66	5.795

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001156	2933732	MAG	Austria	Europe

• Gene Location: Start: 63214; End: 64971 Strand: -

Full Sequence      

MKETLFGAVRAKASFEVQFTHSEEREGARVKHTFSVTWKPEDAKRAEKPCLTLECVKEPL
DIQYQWHTNCHTDRALKPNWACLQKSKISSGAPIQVFYNDAGMNRLTVALDDCTTLIERR
LGLAEEDGMLGIQFVIPLDGTGETNRYAVTLWLDETDCRYEEAIRAVTRWWEKKYPPMNV
PGAAKLPLYSFWYSFHQAVYEQEVEAECARALRLGLKTVIVDDGWQTEDNSRGYAYCGDW
QPAHAKIADMAAHVARVHAMGLKYVLWYSVPFVGKYSEAAKRFEGKTLEFLPNMGAYTLD
PRYPEVRVYLIDLYKRALVDWNLDGFKLDFIDSFRMAENTPAFAEGMDYVILEDAVRRLM
VDVMKTLTAIKPDVLIEFRQSYIGPVMREFGNMFRVGDCPFTTSTNRIGMVDIRLLCGDT
AAHSDMLAWHVNDRVENAVCQIENVLFSTVQFSARLDRVPEEHVKAIRFWTEFMTREHAL
LVDTPIYAECPQMLYPVVRAQKDGRAVLACYERNYLVEIPARLREVILVSANAGRELLAR
FSESAQWNAVVRSCTGDVVREETLHLDGVVSLPVPECGLIHLTRV

Enzyme Prediction     

No EC number prediction in MGYG000001156_01353.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.02e-56	184	473	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	2.60e-06	176	331	1	125	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	8.20e-06	160	433	274	534	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	4.40e-05	187	330	3	151	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06593	GH31_xylosidase_YicI	2.17e-04	183	348	3	173	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJD86820.1	1.65e-150	36	580	34	598
QMV40951.1	4.70e-146	43	582	38	585
AZN41080.1	6.84e-146	60	579	64	594
AIQ22829.1	5.83e-145	49	585	36	576
CQR57728.1	1.32e-144	46	582	46	587

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001156_01353.