CAZyme Information: MGYG000001130_00827

Basic Information

• Species: Collinsella sp900757615
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900757615
• CAZyme ID: MGYG000001130_00827
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	MGYG000001130_27|CGC1	36581.79	6.051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001130	2064336	MAG	China	Asia

• Gene Location: Start: 20960; End: 21952 Strand: +

Full Sequence      

MASEVDYPLVSIIVPMYNVGTFALPCVRSLLNQTYPNIEILIVDDGCTDNTIDLIEDTVG
DDPRVVIHHKENGGLSSARNYGTQRCHGNYLMYVDGDDLIDPRTVELMVEAALKYQVTLV
AGSFAKTPLLENYEMEQAAEFKVESGAERFRKLLLFNGESGSACGKLFARPLIPYLSFPE
GQLFEDMGVIASICSRVGEITFSDAPFYAYVTRPGSITTFKKQGPKHAQDMDVTIETVRQ
IAGGGFKDEFECFRAYCTLRVAMRVDLDAFGDRAEGRSYLRRARELAGRASRSPLASRKW
RLRCTLFAISPKAHNAFYALYAAVSGKAIG

Enzyme Prediction     

No EC number prediction in MGYG000001130_00827.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	11	129	2.5e-31	0.7058823529411765

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.84e-34	11	173	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	6.32e-32	12	154	1	148	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
PRK10073	PRK10073	1.77e-27	8	114	6	112	putative glycosyl transferase; Provisional
COG0463	WcaA	2.47e-27	6	111	1	107	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
PRK11204	PRK11204	8.25e-26	6	115	52	162	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP53428.1	1.10e-43	6	218	2	213
AHJ20634.1	2.36e-39	1	219	1	220
AUD70395.1	2.36e-39	1	219	1	220
AHF26397.1	2.49e-38	1	219	1	220
AAV62656.1	4.67e-38	9	217	6	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.00e-22	9	213	6	218	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
2Z87_A	1.35e-18	8	110	374	476	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	1.35e-18	8	110	375	477	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
3BCV_A	1.09e-16	8	115	5	112	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6P61_A	2.33e-11	8	108	13	113	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2URH7	1.04e-24	10	246	7	250	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1
A0A0H2UR96	5.33e-24	9	217	4	221	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
P71059	5.52e-24	8	126	3	121	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1
Q57022	2.56e-20	6	180	2	170	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
P71057	2.98e-20	6	217	2	218	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001130_00827.