CAZyme Information: MGYG000001093_01553

Basic Information

• Species: Flavobacterium lindanitolerans
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Flavobacteriales; Flavobacteriaceae; Flavobacterium; Flavobacterium lindanitolerans
• CAZyme ID: MGYG000001093_01553
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000001093_94|CGC1	44039.6	6.6997

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001093	3659018	MAG	Sweden	Europe

• Gene Location: Start: 746; End: 1894 Strand: -

Full Sequence      

MRILLVGEFSRLHNSLKEGLTALGHEAHIVGTGDDFKKYPVDFPISSTLVASNSLLRFCN
RITRKLFRLDLEAYERTYRFRKLLPILKGYDVVQLINSNAIETYPKLALRLYEKLFAQNS
KKFLLICGDETPIVDVLLKNNLKYSVLTPYFNDPAANKYYNYTLNYTNNQQRKLFDFVQT
NCDGLLVSDLDYKIPMEQTGFDFTFIPNPINTDKLEFIPMEIPSKIVIFHGVNKYSAVKK
GSSVFLEALSKIELKYGNKVEIRIVNSLPYDEYQKHIRSAHIILDQIYAFDQGYNALEAM
ALGKVVFTGAETEFQEYYQLTDSVAINALPDVESIVQQLSFLIENPEELTLIGKRARQFI
EKEHHFVKIAEIYTESWNTTNP

Enzyme Prediction     

No EC number prediction in MGYG000001093_01553.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	2.54e-09	202	373	165	361	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	6.67e-09	172	373	141	370	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam13524	Glyco_trans_1_2	1.21e-07	287	371	7	89	Glycosyl transferases group 1.
cd03825	GT4_WcaC-like	2.14e-06	205	375	165	359	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
pfam00534	Glycos_transf_1	3.04e-04	241	359	40	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSB26175.1	6.46e-146	1	378	1	374
AXG74939.1	2.62e-143	1	377	1	379
QEE51293.1	2.39e-140	1	377	1	377
QBN20068.1	2.93e-140	1	378	1	378
AWM12630.1	2.31e-138	1	377	1	377

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001093_01553.