CAZyme Information: MGYG000001091_01367

Basic Information

• Species: Citrobacter_A sp009363175
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A sp009363175
• CAZyme ID: MGYG000001091_01367
• CAZy Family: CBM5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		36142.43	4.3101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001091	4193018	MAG	Sweden	Europe

• Gene Location: Start: 4570; End: 5604 Strand: -

Full Sequence      

MNESLLGGSSTPVDPVVTNHAPIASAADQNVTGPVTVTLDGSASSDPDGDAMTYKWTQVS
GPAVTISNSAKAKASFNVAAATSDQTMVFRLTVTDAKGLKNAVDVQILNKAPKANQAPVV
NQMETITLQAGESHSLHAQAADPDGDALTYTWSVPADMQATGTNTANVNITAPEVSSEST
YTLSVIVSDGKTSVQSNVQVVVTPKPADEGNTPSDEGNTPSDEGNTPSDEGTANNSCDKP
VDANASKYAAWSASKVYNSGNTVSFDNLVWKAKYWTQGNQPGFGVDAWELVSKVSMNWRS
DVVYNSGETTTYQGSVYRAKWWTRGDKPGNSDVWVKEGASADCK

Enzyme Prediction     

EC	3.2.1.14

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd12215	ChiC_BD	1.41e-12	249	290	1	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
cd12215	ChiC_BD	2.20e-10	298	334	3	40	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00495	ChtBD3	1.28e-08	248	288	1	41	Chitin-binding domain type 3.
cd12204	CBD_like	2.99e-07	243	292	1	48	Cellulose-binding domain, chitinase and related proteins. This group contains proteins related to the cellulose-binding domain of Erwinia chrysanthemi endoglucanase Z (EGZ) and Serratia marcescens chitinase B (ChiB). Gram negative plant parasite Erwinia chrysanthemi produces a variety of depolymerizing enzymes to metabolize pectin and cellulose on the host plant. Cellulase EGZ has a modular structure, with N-terminal catalytic domain linked to a C-terminal cellulose-binding domain (CBD). CBD mediates the secretion activity of EGZ. Chitinases allow certain bacteria to utilize chitin as a energy source. Typically, non-plant chitinases are of the glycosidase family 18.
smart00495	ChtBD3	1.57e-06	298	332	4	38	Chitin-binding domain type 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKE58387.1	2.48e-180	1	344	555	919
AWS78828.1	6.77e-158	1	344	555	900
AXO43812.1	6.77e-158	1	344	555	900
BBW30545.1	1.91e-157	1	344	555	900
ARA25724.1	1.91e-157	1	344	555	900

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4TXG_A	9.32e-08	232	293	45	98	CrystalStructure of a Family GH18 Chitinase from Chromobacterium violaceum [Chromobacterium violaceum ATCC 12472]
2D49_A	8.28e-06	250	288	6	43	ChainA, chitinase C [Streptomyces griseus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P32823	2.42e-22	17	292	590	819	Chitinase A OS=Pseudoalteromonas piscicida OX=43662 GN=chiA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999687	0.000356	0.000001	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001091_01367.