CAZyme Information: MGYG000001089_02425

Basic Information

• Species: Clostridium sp000435835
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium sp000435835
• CAZyme ID: MGYG000001089_02425
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
483	MGYG000001089_189|CGC1	55979.84	5.5901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001089	3268107	MAG	Sweden	Europe

• Gene Location: Start: 9665; End: 11116 Strand: -

Full Sequence      

MGFPKNFLWGGATAANQCEGGYNEGGRGLANVDLMPLGKDRYRVGTGEIRMFDFDENYFY
PAQKSIDMYHKYKEDIALFAQMGFKTYRMSIAWTRIFPNGDEEKPNEEGLAFYEDMFKEC
KKYDIEPLVTINHFDCPMYLIKKYGGWKNRKMIDFYVKFAKALFSKYKGLVKYWLTFNEI
NMILHFPFVAAGLYFEKGENKKQVMITAVHHELIASALVTKIAHEIDPNNKIGCMMAAGS
YYPETCKPEDYWKSICDNRESYMFIDVQSWGYYPNYALKWVEKQGAVIPFENGDKEILLN
NTVDFISFSYYSSRVSSENPEKAKQTESNIFASVINPYLKASDWGWQIDPLGLRITMNEL
YDRYKKPLFIVENGLGAADKIENNGKIIDDYRIEYLKEHIQAMKDAIDEDGVDVMGYTSW
GCIDLISNGTGEMKKRYGFIYVDRDNEGNGTLKRIPKKSFYWYKRVIATNGENLSLEGLD
LYE

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	471	4.7e-145	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	474	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	475	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	474	4	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	477	2	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	475	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL59044.1	6.58e-287	1	474	1	474
QUN12274.1	2.03e-285	1	474	1	473
ASW43861.1	1.36e-274	1	474	1	474
BCA85378.1	3.07e-274	1	477	1	477
AYW51440.1	2.06e-272	1	475	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.60e-207	3	474	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	7.34e-182	4	474	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4IPL_A	1.33e-181	3	474	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
4F79_A	2.09e-181	4	474	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
2XHY_A	6.20e-178	4	474	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	6.95e-217	3	474	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	3.54e-206	3	474	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	8.23e-189	1	474	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	6.34e-180	4	474	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	3.39e-177	4	474	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001089_02425.