CAZyme Information: MGYG000001078_00726

Basic Information

• Species: Rothia sp001808955
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Micrococcaceae; Rothia; Rothia sp001808955
• CAZyme ID: MGYG000001078_00726
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310	MGYG000001078_108|CGC1	31996.97	4.3694

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001078	1984981	MAG	Sweden	Europe

• Gene Location: Start: 2880; End: 3812 Strand: +

Full Sequence      

MDHLSTPGQAPAAFASHPLASVASLASGADASHETSTKASYQDALLFIAPPLLSAAVLGA
LSVNLHRIPSAHPLADASLLCAGAAAILITAWWFVSFICALFYARSLRVSSRNADRAVLQ
VPAIFRPRFMRRIVLTLGGTALGVGAVLAPAQATVATPSNAGLNSAEGIPQTTISAVMAA
DSSITAAADASSDAVLSDTAPNQSATPLTLSAEVPNIPLAPEPSEAAGSLQDRSPFFSPP
RTEAGTYSYTVQAGDTLWSIAADQLGEGTDASTIYDYTLDIYEANKDALGQNAELLYEGQ
VLQIPEQPVH

Enzyme Prediction     

No EC number prediction in MGYG000001078_00726.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11198	PRK11198	1.21e-09	249	306	98	147	LysM domain/BON superfamily protein; Provisional
cd00118	LysM	1.43e-08	248	304	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
COG1652	XkdP	6.39e-07	149	307	113	264	Nucleoid-associated protein YgaU, contains BON and LysM domains [Function unknown].
smart00257	LysM	1.36e-06	249	304	2	44	Lysin motif.
pfam01476	LysM	1.41e-06	249	305	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF63722.1	6.76e-182	1	310	1	305
QXW98223.1	2.28e-165	1	310	1	320
BAS20589.1	1.45e-146	1	310	1	346
VEI23440.1	8.77e-16	43	305	11	258
VEJ29802.1	1.25e-13	92	307	60	341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999621	0.000397	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
44	66
81	103
133	155