CAZyme Information: MGYG000001074_01234

Basic Information

• Species: Prevotella sp002251365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251365
• CAZyme ID: MGYG000001074_01234
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551		63580.95	6.3291

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001074	2078798	MAG	Sweden	Europe

• Gene Location: Start: 27; End: 1682 Strand: +

Full Sequence      

MELVRASSLYTVHTPVPAGHDYFDEGLFGKYMGGYPAKLGISWDEFIGMGRQNPDDHSER
FCMSTFACNTCQEVNGVSKLHGWVSQKMFAPIWNGYYPEENHVGYVTNGVHFPTWAATEW
KQLYGKYFDKNFMSDQSNQNIWEAIYNVDDEEIWKTRKGLKQKLVDYIRVQFRETWLKNQ
GDPSRVVSLLESIDSNALIIGFCRRFATYKRAHLLFTDLDRLSKIVNNPERPVKFLFAGK
AHPADGAGQGLIKKIYEISQRPEFLGKIIFLEDYDFMLARRLVSGVDIWMNTPTRPLEAS
GTSGEKAEMNGVVNLSVLDGWWLEGYREGAGWALTEKRTYQNQGHQDQLDAATIYSLLEN
EIIPMFYNKNKKGYSEEWIQVIKKSIATIAPHYTMKRQLDDYYDRFYCKEAARFKKLSAD
NNRLAKDIAQWKETVAERWDSIKVVSKENPILDNAAETGVTYKLRYVIDEQGLNDAVGLE
LVVLSNVRDGGDREVHNVYPFDMVGHEGNLYTFEANVEPYAAGSYRCCVRMFPKNENLPH
RQDFCYVKWLD

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	2	431	8.2e-104	0.6097922848664689

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02094	more_P_ylases	0.0	1	409	194	601	alpha-glucan phosphorylases. This family consists of known phosphorylases, and homologs believed to share the function of using inorganic phosphate to cleave an alpha 1,4 linkage between the terminal glucose residue and the rest of the polymer (maltodextrin, glycogen, etc.). The name of the glucose storage polymer substrate, and therefore the name of this enzyme, depends on the chain lengths and branching patterns. A number of the members of this family have been shown to operate on small maltodextrins, as may be obtained by utilization of exogenous sources. This family represents a distinct clade from the related family modeled by TIGR02093/pfam00343.
cd04299	GT35_Glycogen_Phosphorylase-like	0.0	1	498	280	775	proteins similar to glycogen phosphorylase. This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences. Oligosaccharide phosphorylase catalyzes the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism.
COG0058	GlgP	8.98e-116	2	407	299	701	Glucan phosphorylase [Carbohydrate transport and metabolism].
cd04300	GT35_Glycogen_Phosphorylase	3.70e-13	63	320	408	661	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
PRK14986	PRK14986	8.92e-08	55	320	415	676	glycogen phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB27772.1	0.0	1	551	303	853
BCS84327.1	0.0	1	551	303	853
QYR10579.1	0.0	1	551	303	852
VEH15051.1	0.0	1	551	303	853
ALO48848.1	0.0	1	551	303	853

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	7.14e-10	56	320	363	622	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2GM9_A	2.68e-08	74	320	441	683	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
2FFR_A	2.68e-08	74	320	441	683	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
2GJ4_A	2.68e-08	74	320	441	683	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
7O8E_A	2.69e-08	74	320	446	688	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9YGA7	1.06e-120	1	549	299	825	Maltodextrin phosphorylase OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) OX=523849 GN=malP PE=1 SV=1
O66932	1.25e-113	1	409	285	686	Glycogen phosphorylase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=glgP PE=3 SV=1
P9WMW0	2.17e-99	1	492	313	803	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgP PE=3 SV=1
Q7U078	2.17e-99	1	492	313	803	Glycogen phosphorylase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=glgP PE=3 SV=1
P9WMW1	2.17e-99	1	492	313	803	Glycogen phosphorylase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001074_01234.