CAZyme Information: MGYG000001074_00959

Basic Information

• Species: Prevotella sp002251365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp002251365
• CAZyme ID: MGYG000001074_00959
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		36217.99	8.0994

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001074	2078798	MAG	Sweden	Europe

• Gene Location: Start: 1476; End: 2453 Strand: -

Full Sequence      

MRIDYVSPVNEPDGHWNWLGPKQEGSPATNREISRLAKETSKAFKKDKLQTEIVLNESSD
IRCLLGTYMAGWERGNTISTLFTKDSAKISVNGLPNIPNIVLGHSYWTNTPVDTMRSIRL
RLRDTLAKHNLKYWQSEICIMGNDEEIGGGGNFDFSMKTALYVARVMHYDLVYGNACSWS
WWRACGGNYKDGLIRIYSDDGMKTGHAVDSKLMWAMGNYSRFVRPGAVRLSVKAYDKDGN
EVSEGDTRPYGAMLSAYRNKDGKLAVVAINYSESLLPISIKVDGNGSNWKLYRTSDISAE
SLAPVGTAGTEITLTPRSITTLVEE

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	2	323	1.3e-95	0.6446280991735537

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.82e-53	4	194	175	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	7.98e-06	3	323	169	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	2.44e-05	226	322	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVJ80557.1	4.63e-148	1	325	190	506
QNT66373.1	6.72e-147	1	325	199	524
VEH15028.1	4.63e-146	1	323	195	517
BCS84535.1	1.75e-145	1	323	193	515
EFI72737.1	1.35e-139	1	325	192	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.08e-43	1	295	176	468	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
4CKQ_A	1.29e-11	134	323	245	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4UQA_A	1.29e-11	134	323	245	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
5A6L_A	7.42e-11	160	323	265	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5A6M_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus ATCC 27405]
7O0E_A	1.11e-08	164	323	296	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	6.31e-08	164	323	320	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001074_00959.