CAZyme Information: MGYG000001073_01807

Basic Information

• Species: Fusobacterium_B sp900554885
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium_B; Fusobacterium_B sp900554885
• CAZyme ID: MGYG000001073_01807
• CAZy Family: PL8
• CAZyme Description: Xanthan lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
805	MGYG000001073_188|CGC1	91423.08	6.6474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001073	2595353	MAG	Sweden	Europe

• Gene Location: Start: 12853; End: 15270 Strand: +

Full Sequence      

MKRKLVLLSMIAILTNVSFGEEIGKSEKIVACQLEKNEIKDCRKIINKWQEFLIGLPNSD
SQIKMTDEEIKKVVSFNEKNADGYYSDINLSKDRKSIFKSFENMKSGVDVLKQYDGLVKI
VKAYATPGTKYYKKEEIKTQVIDALDWLYDNAYHENLPELGNWWQWEIGIPKKLNEILAI
MYDEVPKDKKIKYLKASQYFQPYAKWSAFSPSASYSSAPHKRISTGGNRIDTSLICFIRG
VLMEDRTQILDGLNSVAEVGKIVTEKDGFYKDGSFVQHDNVAYNGTYATVLFDGLGMILE
LIDGTEFKIESPEINNIYDSILKGYSYLMINGGVNDSVSGRSISRDNSSEIERGRDLVSS
ITLLSSKAPKEYRNDLYSMIKKIVLDNNFYSVIKKESKPKIKNILENIIADENIKPLKVE
GTKIFGAMDRAVYTNSKEGKVVLSMHSNRIANYETMNEENLKGWYTGDGMTYIYGKDSSS
FVEFWPTADMYHLSGVTNSINKMENKAGERREKPTVSPKKFVGGVETGDVAFVGMDFISW
NNKTTAKKSWLMIDGAVLALGSNITSTDGEIHTTIDNRILKKGKIYIDGKELNKNSTIKD
PKNLTINFNENYPDENIGYKIINSPELNINFTENKGSWKDIGGTLDTEIVKQYFSVYLNY
GKDPKDETYAYVILPMFSKDEVENYDTSRFKIEKLDDKAHIVRDAKTDIVAINFWNNGEN
EFEGIKTKYPLSIIKDEEDGILKLYVSDPTQAKNENVSLEISGKYKLIEKSSDKIFVKTE
NGVTKLNIDLKNNGSTEKIELKKIK

Enzyme Prediction     

No EC number prediction in MGYG000001073_01807.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL8	423	679	2.9e-71	0.9884169884169884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01083	GAG_Lyase	0.0	43	749	3	693	Glycosaminoglycan (GAG) polysaccharide lyase family. This family consists of a group of secreted bacterial lyase enzymes capable of acting on glycosaminoglycans, such as hyaluronan and chondroitin, in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen. These are broad-specificity glycosaminoglycan lyases which recognize uronyl residues in polysaccharides and cleave their glycosidic bonds via a beta-elimination reaction to form a double bond between C-4 and C-5 of the non-reducing terminal uronyl residues of released products. Substrates include chondroitin, chondroitin 4-sulfate, chondroitin 6-sulfate, and hyaluronic acid. Family members include chondroitin AC lyase, chondroitin abc lyase, xanthan lyase, and hyalurate lyase.
pfam08124	Lyase_8_N	4.11e-89	49	381	1	322	Polysaccharide lyase family 8, N terminal alpha-helical domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02278	Lyase_8	3.26e-72	422	675	1	249	Polysaccharide lyase family 8, super-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.
pfam02884	Lyase_8_C	2.48e-09	696	751	4	61	Polysaccharide lyase family 8, C-terminal beta-sandwich domain. This family consists of a group of secreted bacterial lyase enzymes EC:4.2.2.1 capable of acting on hyaluronan and chondroitin in the extracellular matrix of host tissues, contributing to the invasive capacity of the pathogen.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVQ18405.1	0.0	1	805	1	805
QNM15134.1	0.0	1	805	1	805
BBM36588.1	1.46e-270	35	804	21	787
AVL42971.1	1.92e-196	37	801	19	736
ACZ00618.1	1.92e-196	37	801	19	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1F1S_A	1.68e-94	15	759	55	814	CrystalStructure Of Streptococcus Agalactiae Hyaluronate Lyase At 2.1 Angstrom Resolution. [Streptococcus agalactiae],1I8Q_A Crystal Structure Of Streptococcus Agalactiae Hyaluronate Lyase Complexed With Enzyme Product, Unsaturated Disaccharide Hyaluronan [Streptococcus agalactiae],1LXM_A Crystal Structure of Streptococcus agalactiae Hyaluronate Lyase Complexed with Hexasaccharide Unit of Hyaluronan [Streptococcus agalactiae]
1N7O_A	4.50e-92	46	675	9	630	ChainA, hyaluronidase [Streptococcus pneumoniae]
1OJM_A	5.39e-92	46	675	9	630	SpecificityAnd Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With Unsulphated Chondroitin Disaccharide [Streptococcus pneumoniae]
1C82_A	5.63e-92	46	675	11	632	MechanismOf Hyaluronan Binding And Degradation: Structure Of Streptococcus Pneumoniae Hyaluronate Lyase In Complex With Hyaluronic Acid Disaccharide At 1.7 A Resolution [Streptococcus pneumoniae],1EGU_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase At 1.56 A Resolution [Streptococcus pneumoniae],1F9G_A Crystal Structure Of Streptococcus Pneumoniae Hyaluronate Lyase Cocrystallized With Ascorbic Acid [Streptococcus pneumoniae],1OJP_A Specificity And Mechanism Of Streptococcus Pneumoniae Hyaluronate Lyase: Complex With 6-sulphated Chondroitin Disaccharide [Streptococcus pneumoniae],1W3Y_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with palmitoyl-vitamin C [Streptococcus pneumoniae],2BRP_A Crystal structure of S. pneumoniae hyaluronate lyase in complex with W249b [Streptococcus pneumoniae],2BRV_X Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 70percent saturated malonate. [Streptococcus pneumoniae],2BRW_A Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae],2BRW_B Crystal structure of Streptococcus Pneumoniae Hyaluronate Lyase from 30percent PEGMME. [Streptococcus pneumoniae]
1LOH_A	1.69e-91	46	675	9	630	ChainA, Hyaluronate Lyase [Streptococcus pneumoniae],1LXK_A Chain A, Hyaluronate Lyase [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q53591	5.31e-90	15	759	225	984	Hyaluronate lyase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=hylB PE=1 SV=2
Q54873	3.33e-89	15	675	265	916	Hyaluronate lyase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0314 PE=1 SV=2
Q9AQS0	5.99e-82	48	762	35	735	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1
Q59801	1.77e-78	41	717	48	732	Hyaluronate lyase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=hysA PE=3 SV=1
P0CZ01	2.18e-52	123	789	117	783	Hyaluronate lyase OS=Cutibacterium acnes (strain DSM 16379 / KPA171202) OX=267747 GN=PPA0380 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000330	0.998955	0.000235	0.000156	0.000159	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001073_01807.