CAZyme Information: MGYG000001072_01615

Basic Information

• Species: CAG-317 sp900543415
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-317; CAG-317 sp900543415
• CAZyme ID: MGYG000001072_01615
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874		94026.29	4.8181

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001072	2601066	MAG	Sweden	Europe

• Gene Location: Start: 19037; End: 21661 Strand: -

Full Sequence      

MNYGRKNAAKKQKKITSKSTMQGKRVGVRLFKAFLLCLVVIAIVGIIGGGLFVKRIIDNA
PEVTPDDVKPKGFTTFVYADDGKTELERFVASGSNRIYKTLDEIPKDLGNAFVAIEDERF
YEHNGIDLHGIIRAGIATLSGNEQGASTLTQQLIKNNVFPNFIHEETFYDKVQRKLQEQF
LALQIEKQMSKEEILESYMNTINLGQNCLGVQAAAKRYFGKDVSELTLSECACIAGTTQN
PSGYNPINNPEDNNKRRKSVLKNMLEQGYIDQAAYDEAINDDVYARIQTVNSSSEEKKPT
SYFVDALSEQVMQDLQDQLGYTETQAYNAVYSGGLSIYSTQNVEMQKICDEEMNDDSNYP
GLKEYGLDYALTVTRADGSVENYGSGHVKKYAKEKHGKKYGLIYSSEEDARAMVEEWKAT
IAQEGDTYDEVINITPQPQASVTIMEQKTGAIKAMVGGRGAKSSSLSLNRAYKGSKRQPG
STFKILAAYAPAIDSCGKSLSTIVVDEPYKYKNGKNVKNASRSYKGAVTYRTAIANSINV
CAVKVSDEISQELGFEYCEKFGISTLVKEKKTDAGVFSDINQTLALGGVTDGVYNYELCA
AYATIANGGTYNTPTLYTKIVDHDGNVLLENPGESHQAIKEGTASLLTSAMETVVTSGTG
RSCQLNNMPVAGKTGTTTSNKDLWFCGYTPYYTCAVWGGYDDNKECNYDTSFRFRIWKGI
MSRIHDGLEYKEFDTTKGLIQKTVCTLTGKLAVAGQCPSATEYFAEGTEPTETCPGHKDV
VSPDGEEDDEDNAEGTAPEQPNTTPSTPNTGNGNNGSGNTGGGNTGGGNTGGGDTGGGNT
GGGDTGGGDTGGGDTGGGTGGDTGGGGNTSGSTP

Enzyme Prediction     

No EC number prediction in MGYG000001072_01615.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	88	264	1.2e-62	0.9548022598870056

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	1.95e-169	95	725	1	529	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.04e-159	59	737	40	609	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.67e-145	67	806	42	796	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.52e-79	96	772	66	830	penicillin-binding protein 1a; Provisional
TIGR02071	PBP_1b	5.43e-78	91	725	142	683	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDW73412.1	0.0	1	786	1	788
QBF72703.1	0.0	1	777	1	783
QRO36088.1	0.0	1	777	1	783
QYX26035.1	0.0	1	808	1	808
QEK18344.1	0.0	1	777	1	771

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	3.34e-100	81	771	25	808	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	3.37e-64	77	771	23	770	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3ZG8_B	1.78e-59	184	743	2	478	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	6.37e-56	184	743	2	478	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
3DWK_A	1.74e-55	81	740	12	606	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5I6G4	4.83e-107	43	772	26	697	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	4.83e-107	43	772	26	697	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
A7GHV1	1.25e-105	43	772	26	697	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
Q0SRL7	2.12e-104	5	777	14	724	Penicillin-binding protein 1A OS=Clostridium perfringens (strain SM101 / Type A) OX=289380 GN=pbpA PE=3 SV=1
Q0TNZ8	1.40e-103	5	780	14	727	Penicillin-binding protein 1A OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999975	0.000056	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
30	52