CAZyme Information: MGYG000001065_02882

Basic Information

• Species: Enterocloster sp900538485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900538485
• CAZyme ID: MGYG000001065_02882
• CAZy Family: PL26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
876	MGYG000001065_69|CGC1	100343.49	5.7835

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001065	3284441	MAG	Sweden	Europe

• Gene Location: Start: 46510; End: 49140 Strand: -

Full Sequence      

MELHRLEGRSAQGMAQFGCIWPKGELHREDALKAVGEDGRKIPLQSRITAYYKDGSIKWT
AHTAKAKGLGEHFCVERLKKGEKEAAAQHSLRLTEQKNGILVETDRVSFFAGASGEKLIS
DYRVDGKCRIMALTSVLRLERRTWEGENVSSAVTGFTGRIQKVTAEEAGPLRAVLKFEGI
HKNDAEEMIPFILRLFVGADDCRLDMQYTFAYDGCEETDFLKGIGLKAVFPAEGKIYNRH
LRFLGDAGSFSESTANLLTWRPKIPEELYEKQCRGEAVFPEGEALERVNTVIKAMPFWDT
YDIVQDAPTHFSIKKKQAGEGLCWIDCIHGLRARGGLAFGSEAGGVMLGVRNFWQTYPSG
YTVKGLSGHEIEAVTWFYSPSSDAFDFGHYANRGYNQSYYEGYDFKGASACGIAVTSECS
LELTKEMCACEETLGAFTESVSNPAVYVGTPEYYHSCRAFGYWSLPEGNTQTERWLEGQL
ERALDFYKQEVDQRNWYGLFNYGDFMHTYDRFRHQWRYDMGGYAWDNTELVPTLWLWLMF
MRTGRADAFEMAERLSRHASEVDVYHFGPYKGMGSRHNVRHWGCPCKEARIAMAAHHRYF
YYLTGDRRMEDIFEELKDNEFTFLRKDPLGEFYDKENMVFPTHARSGPDWSSLCANWMTQ
WERTLDERYLKKIQTGSQDIADTPLRLVSGPDFEFDPASAHLRYIGERATGGTHLQICMG
APSVWMEMADMMEDERWKDMIAEYGEFYYLPREEQLKRSEGSIGERQFTLPFMAAAMGAY
GAVRRKNPWLADTAWRILLHAMVTDLDTEGFVIHEENNVGNRPVLKEIPWISTNFTAQWC
LNVIMVLDFIRERLPRTMEEVKALVAGEPPENWHKA

Enzyme Prediction     

No EC number prediction in MGYG000001065_02882.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	10	854	2e-287	0.9872389791183295

CDD Domains     

MGYG000001065_02882 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEC02734.1	0.0	1	876	3	911
BCJ94257.1	0.0	20	876	1	854
ABX43437.1	4.16e-302	1	857	5	876
AOZ96961.1	2.42e-296	1	859	1	861
AGC67247.1	1.44e-229	7	848	12	845

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	6.99e-127	17	854	25	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_B	1.43e-125	17	854	25	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_A	1.50e-125	17	854	25	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	2.80e-125	17	854	25	901	Crystalstructure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31530	6.92e-220	17	859	19	851	Uncharacterized protein YetA OS=Bacillus subtilis (strain 168) OX=224308 GN=yetA PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001065_02882.