CAZyme Information: MGYG000001065_02881

Basic Information

• Species: Enterocloster sp900538485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900538485
• CAZyme ID: MGYG000001065_02881
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1055	MGYG000001065_69|CGC1	119211.5	5.2146

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001065	3284441	MAG	Sweden	Europe

• Gene Location: Start: 43291; End: 46458 Strand: -

Full Sequence      

MIRCEKIDRNGITITWDETPGETESRLYWADRRHPGTRFLQVKAAGPGEERRFHLNKRTD
IPHYFQVRSVRNGKEQEAQETFETPVTHVRRPQLERLGRGLVAVPAQDGVFLSWRLLLDE
VTGYENERRSLCSPAFTVWRNGEKIGETGESLCYLDSEGKAKDRYQVSRSGDLELCPPVS
VWEKPWFELPLRKPAGGVTPAGEAYTYSANDMSVADVDGDGEYEYFVKWDPSNSHDVSVK
GYTGPVYIDCYKQSGLLLWRLDLGCNIRAGAHYTQFICYDLDGDGKAEMSVKTAPGSRMI
FYGPDGSEIRSRFITMPKEDIRKGYGHNDCYVCSADGYREHLIRVFQSWQDQQEVKDGLW
PGSLEECFGIEPRFSYPLSRKDGAWLADYFLDVYAKKRHAKNDLRRFEGFIYEGPEYLSV
FAGDGQEITTIPFPFPREDDGLRWGDYAMPRIEPCNRSDRFLSAAAYLDGIHPSLIICRG
YYTRSCIAAYDLKKGKLEERFRVDSGHVPMENPFCSHPHAKKGSSTVYGSLAGQGNHSLS
AADVDGDGYMELIFGAAVIDHDGSLLYSSFDRLPDGSLAKLGHGDAIQAAQIDPDRPGME
IFHVFEGAREAPYGYALCQAEDGAVIFGEYAREDLGRCMTGAVISGQRGLSCWVNGVGTF
DCHGNKVRGDTLGSNMIVRFGADYSTQVTDGPDYLGQEARGVVNDWAHGVMLDPGDTLTN
NGTKGNPCLVADLFGDYREELLLRTADSSAIRIYTSLEPSDHKLISLMQDIQYRCGVAWQ
NNCYNQPVYPSFYYAPDLDAEDILPYMKRRPVLYLAGDSVSQSYQEDKRPQAGWGEYLLK
YLCPEAVIQCFHRGDSPFLQERRYQCRNLEVDNCSMGGRSSKTFREEGRLEDIRAHLRPG
DYLLIQFGHNDACASREERFVPEEKFGDSLGHYIRAAREAEAVPVLLTPVSTCIGKHDFS
EEAEEVRGHLASYAAAMKWFADENDIFLIDLFRKTEETQRRLGEEESCRLYITDGIHLTQ
RGARLYAAMAAEALRERLMEEQGHRNIIHNLNRRI

Enzyme Prediction     

No EC number prediction in MGYG000001065_02881.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	400	801	3.3e-120	0.5973597359735974
PL11	93	338	4.3e-74	0.3893653516295026
CE12	813	1034	7e-47	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	94	792	1	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
cd01821	Rhamnogalacturan_acetylesterase_like	3.86e-50	811	1034	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
pfam18370	RGI_lyase	6.47e-22	93	182	2	86	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
COG2755	TesA	5.13e-17	811	1038	9	212	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
cd00229	SGNH_hydrolase	2.09e-11	858	1033	25	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB25238.1	0.0	1	1041	1	1041
QEI31010.1	0.0	1	1041	1	1041
BCJ96196.1	0.0	2	807	5	807
ABX40730.1	0.0	2	804	4	803
AOZ96959.1	2.67e-301	93	799	3	738

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2ZUY_A	6.05e-144	90	817	4	605	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
2Z8R_A	7.43e-138	93	793	4	567	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]
4CAG_A	1.48e-134	86	793	3	574	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2O14_A	2.38e-13	813	1035	165	360	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]
1DEO_A	7.08e-08	813	911	3	75	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31527	2.59e-143	90	817	4	605	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
O31526	9.92e-137	93	793	41	604	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1
O31528	2.85e-28	813	1036	5	204	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
O31523	4.16e-24	807	1036	1	214	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
P42304	7.74e-14	813	1035	180	375	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001065_02881.