CAZyme Information: MGYG000001065_00560

Basic Information

• Species: Enterocloster sp900538485
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp900538485
• CAZyme ID: MGYG000001065_00560
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000001065_8|CGC1	42948.18	4.9269

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001065	3284441	MAG	Sweden	Europe

• Gene Location: Start: 56081; End: 57220 Strand: -

Full Sequence      

MVKEGDNVDQIARTAGIPVEELIWANQLEAPYRLAVGQALFVGTQSSVQAGRPSLYTFGY
VYPFIDRQILDETLPWLTDLYVFSYGFTAEGELIPPQTEDGPVIEAARAAGVRPVMVLTP
LGPDGRFNNHLVTELFASERAVRRLIWRLGAMMTEKEYEGLDIDFEYVSAGDRRDFAEFI
GLCARTFNPFGLTVTAALAPKTSDDQPGLLYEGMDYKAIGEAANRVMLMTYEWGYSQGPP
MAVAPIHMVRRVADYALTRIPAEKVSLGIPNYGYDWPLPYERGVTRARTINTLQAIQLAI
DHGSVIYFDELAKSPYFHYWQYGIRHEVWFEDVRSLKAKFDLIKEKGLTGAGYWQLMSFY
RPNWLLLVRMFELAKGNFL

Enzyme Prediction     

No EC number prediction in MGYG000001065_00560.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	129	356	4.3e-35	0.7027027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02874	GH18_CFLE_spore_hydrolase	3.01e-109	59	367	6	313	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
COG3858	YaaH	1.04e-91	2	371	54	422	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
smart00636	Glyco_18	1.51e-23	151	356	101	331	Glyco_18 domain.
cd06549	GH18_trifunctional	1.71e-21	102	356	51	290	GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain.
pfam00704	Glyco_hydro_18	1.18e-19	137	356	84	304	Glycosyl hydrolases family 18.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRV19273.1	1.91e-180	1	375	5	378
ADL06657.1	1.91e-180	1	375	5	378
ASN96403.1	2.27e-176	1	375	5	378
QRP38807.1	2.27e-176	1	375	5	378
QJU19362.1	1.31e-175	1	375	5	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	8.95e-64	67	375	125	431	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	2.49e-62	2	375	8	429	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]
3CZ8_A	2.96e-53	46	356	4	308	ChainA, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168],3CZ8_B Chain B, Putative sporulation-specific glycosylase ydhD [Bacillus subtilis subsp. subtilis str. 168]
5JH8_A	3.89e-24	124	356	71	299	Crystalstructure of chitinase from Chromobacterium violaceum ATCC 12472 [Chromobacterium violaceum ATCC 12472]
4Q6T_A	4.01e-18	84	354	37	322	Thecrystal structure of a class V chitininase from Pseudomonas fluorescens Pf-5 [Pseudomonas protegens Pf-5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.83e-69	67	378	121	430	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	1.27e-61	2	375	7	428	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	4.94e-61	2	375	7	428	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	1.07e-60	2	375	52	419	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2
O32258	9.14e-21	127	364	101	336	Uncharacterized glycosylase YvbX OS=Bacillus subtilis (strain 168) OX=224308 GN=yvbX PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001065_00560.