CAZyme Information: MGYG000001063_03298

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_03298
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812	MGYG000001063_86|CGC3	93838.32	4.5909

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 86746; End: 89184 Strand: -

Full Sequence      

MITQKLSENWFLQITDRQERIPAAVPGSVYNDLLAAGQMEDPFWRDNEMQALKIMENDFI
YSCEFAVTDDILEADANMLHFDGIDTIADIMLNSSHLGNARNMHRIWEYDVTGMLKKEGN
LLTVHIYSPTKFIKKCMEEVITLGTPDCMEGFPQIRKAHCMFGWDWGPRLPDAGIWRDVT
ITGISCGKIDSVYITQVQENEAVRLSLDVELAKLPDQKDTEFTYEVQITDPNGKMTAHSQ
SPKELLIEDPLLWWPNGFGSQPLYTVEVILSADGCIVDSWKRRIGLRTMGIQQKKDEFGE
SFAHEVNGIAIFAMGADYIPEDNIFPRITKERTRTLLEQCAAANFNCIRVWGGGYYPDDY
FFDICDELGLIVWMDFMYACAVYELTDDFDENIRAEIEENVKRIRHHASLGLWCGNNEME
MFVDAGDCVNTPKQKADYIKMYEYIFPQIMKRCDPNTFYWPASPSSGGSFDFPNDPDRGD
VHYWDVWHGGKPFSEFRKFYFRYASEFGFQSFPCSKTVESFTLPEDRNIFSYVMEKHQRN
NSANGKIMNYLSQTFLYPKEFPVLLYASQLLQAEAIRYGVEHFRRNRGRCMGAVYWQLND
CWPVASWSSIDYFGRWKALHYAAKRFFAPVLLSCQEEGFLTQSANINEEPKEYEKSVRFN
VSNETLKERVLTIVWSVRDALANVRREETIELKVGELDSVWCEKILLPDINIYDEYVSYE
LLEDGKSVSSSSVIFSVPKYFHYEDPKLSCRVQGDEIIVTASAYAKSVEIRNKEEDLILS
DNYFDMDAGTKKVRIISGVPEELQLRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000001063_03298.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	688	9.7e-102	0.6675531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.36e-90	4	633	13	635	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.29e-14	189	287	3	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	3.08e-11	78	418	129	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	1.47e-09	745	810	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	0.001	173	295	168	284	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEF82182.1	0.0	1	812	1	816
QBE97789.1	0.0	1	812	15	837
QIB54534.1	0.0	1	812	1	823
QMW79049.1	0.0	1	812	1	823
QJU13790.1	0.0	1	812	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.78e-152	1	812	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.86e-152	1	812	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	2.04e-151	1	812	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	2.10e-151	1	812	3	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	9.27e-145	6	797	11	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	5.48e-112	1	631	20	692	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	1.11e-110	1	631	20	692	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
Q0CCA0	1.44e-108	23	799	30	829	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A2QYN2	2.06e-108	6	637	9	663	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
B8NW36	4.02e-108	6	799	9	830	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001063_03298.