CAZyme Information: MGYG000001063_00519

Basic Information

• Species: Robinsoniella sp900540475
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900540475
• CAZyme ID: MGYG000001063_00519
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
595	MGYG000001063_20|CGC2	69868.22	4.729

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001063	7637037	MAG	Sweden	Europe

• Gene Location: Start: 65277; End: 67064 Strand: +

Full Sequence      

MMRSYKKDYPRPQLVRQEWENLNGTWDFLFDDRNVGEKEKYYAKFPGELKIQVPFTYETK
LSGIGDESRHDHVWYRKTFKADKNRLEKENLMLHFEGSDFYTKVWVNGELAGSHRGGYSR
FSFDISSFIIDGENEIVVKADDSFDMAQPRGKQRWKDENFGCWYVQTTGIWKTVWMEYVP
VTNLASLKITPLLDKDCAELELEIKSSGYSRELTAEVEISFQGTFVNKSVIAVPESHVTA
RMNVFSQEADEWGVRTWSPERPDLYDISIRILEDGKVCDEVQSYFGMREIRIDRGNILLN
GRPLYQRLILDQGYWEDSHLTPPNEEALVEDIDKIMQLGYNGLRKHQKVEDERFLYWCDV
KGMLVWSEVPAAYRFSDEAVREFTEEWMDIVRQNYNHPSIITWTPFNESWGIPKVETDKK
QQQFTEAIYYLTKSFDQFRPVIVNDGWEHTISDIITLHDYEEYGELFYDRYNQYKEEIFT
TDIYHSNHKSAMANGYAYKGQPVIISEYGGIAFQNGESGWGYGNKVQDEAEFIRRFDSIT
TAIKKTPYICGFCYTQVTDVQQEINGLMNIDRSFKVSPEAIKEINERSGGYWRAE

Enzyme Prediction     

No EC number prediction in MGYG000001063_00519.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	14	499	2.4e-99	0.5558510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.34e-36	22	432	15	433	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	8.02e-35	11	444	3	449	beta-D-glucuronidase; Provisional
PRK09525	lacZ	1.21e-19	75	441	124	485	beta-galactosidase.
PRK10340	ebgA	1.73e-19	3	409	18	450	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	4.61e-16	20	139	2	132	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW79090.1	0.0	2	594	1	597
QIB54575.1	0.0	2	594	1	597
QBE97709.1	0.0	2	594	1	597
QJU13750.1	0.0	2	594	1	597
ASU28895.1	0.0	2	594	1	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.69e-87	8	587	28	581	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3FN9_A	2.13e-30	51	575	39	568	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
4JKM_A	1.47e-29	21	443	17	446	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
6XXW_A	4.92e-26	9	592	23	596	Structureof beta-D-Glucuronidase for Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6D50_A	2.11e-25	12	575	28	603	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	2.58e-40	20	480	54	503	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	5.60e-31	20	469	17	436	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	1.39e-26	21	409	50	433	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q8FKG6	7.06e-24	11	455	44	500	Beta-galactosidase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=lacZ PE=3 SV=1
A1A831	3.84e-23	11	455	44	500	Beta-galactosidase OS=Escherichia coli O1:K1 / APEC OX=405955 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001063_00519.