CAZyme Information: MGYG000001058_00561

Basic Information

• Species: UBA6398 sp900550635
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp900550635
• CAZyme ID: MGYG000001058_00561
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	MGYG000001058_98|CGC1	93160.43	8.9879

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001058	2245359	MAG	Spain	Europe

• Gene Location: Start: 8850; End: 11312 Strand: -

Full Sequence      

MIDEKIRCYILSSAPETAAQTAAELQANGYNKPVYLIKTKNESNTADQLNSREPEKKHII
TTKAPESTETLEKMYKHTSTPYILWFKKASSLKLASNALTKLIETAERTKAAIVYADHYD
VKNGATEEHPLIDYTSGSVTDDFDFGSLLLISTKALGEYLASPAKEQYRYAGFYYFRLWA
SISAPIVHINEYLYEEIETDLRLSGQKQFDYVDPRNRRRQMEMEYAFSQYLIKINAFIPP
YEEKRVDFSKEEFDTEASVIIPVRNRARTVKDAVESALSQKTNFPFNVIVVDNHSTDGTT
EILNSLKKDKRLVHIIPRRTDLGIGGCWELAAKSKKCGRFAVQLDSDDLYADENTLQLIV
NEFRRTNAAMVIGSYRMVNFKLETLPPGVIDHKEWTPENGRNNALRINGLGAPRAFYTPL
LRKMGVPNTSYGEDYALGLVFSREYYIARIFDVVYLCRRWEGNSDAALSQEKINKNNAYK
NSLRANEILQRQKLNRAWQHRATQRGTINFFNKQLGKWKEVAERFEKLNDVETKELPFGN
TYIAAQFNPARIVSTGAKVDKRSISKRPCFLCEKNRPAQQISLPVYGTYNILVNPFPILP
CHLVIASRFHKPQSIAGHYDTLVDLAKALKDFTVFYNGPTSGASAPDHLHFQAGLRGVMP
IEKNWDTYSRKLKEIYNCKYHGKSGSIYGITNYACPALAIISESGAINKGLFQLLSLILK
NVKGSAEFPLNVIAWNDNGKITSVIFLRKKLRPECYFAQGEEQLLVSPGAVDMCGLLITP
RKEDFDKLTPEKAISILKEVTVSEQEFEEIAQQLSKIIIH

Enzyme Prediction     

No EC number prediction in MGYG000001058_00561.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	258	379	1.3e-20	0.7

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	2.72e-86	618	808	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	5.00e-21	259	385	1	124	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	2.91e-19	258	379	1	119	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	6.69e-15	258	465	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0463	WcaA	1.92e-14	258	535	6	291	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUB41125.1	2.19e-275	3	815	4	800
QUB57862.1	1.43e-274	4	814	5	797
QUB56535.1	1.43e-274	4	814	5	797
QUB65927.1	1.14e-273	4	814	5	797
QUB62779.1	1.14e-273	4	814	5	797

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4UM29	3.72e-09	254	381	292	414	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
Q92IF9	3.38e-08	254	381	292	414	Uncharacterized glycosyltransferase RC0461 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) OX=272944 GN=RC0461 PE=3 SV=1
Q9FLP9	9.33e-07	591	810	172	384	GDP-L-galactose phosphorylase 2 OS=Arabidopsis thaliana OX=3702 GN=VTC5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001058_00561.