CAZyme Information: MGYG000001039_01938

Basic Information

• Species: Phocaeicola sp900553185
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900553185
• CAZyme ID: MGYG000001039_01938
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380	MGYG000001039_135|CGC1	43131.51	9.3011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001039	3066315	MAG	Denmark	Europe

• Gene Location: Start: 280; End: 1422 Strand: -

Full Sequence      

MKYYLIVGEASGDLHASNLMRALKKLDDEAEFRFFGGELMAKVGGTCVKSYKDMAYMGFI
PVLMHLRTIFRNMDFCKADIVSWNPDVLILVDYPGFNLKIAKYIRAHTSIPVYYYISPKI
WAWKEYRIKNIKRDVDELFSILPFEIAFFQKHRYPIHYVGNPCVDAVAEFGKVRKQTFED
FVKKHGLQEKPIVALLAGSRKQEIKDNLTRMIAVARNYPEYQFVVAGAPGIDPAFYSNFM
QENISIVFGETYSLLQQATAALVTSGTATLETALFRVPQVVCYYTVAGKLVSLLRKCILK
VKYISLVNLIAGKEVVTELVADGMTVDRINQELKAILPAGDKRQQMLEEYDRIIDVLGKP
GASERAAGQMIELLQKRKSL

Enzyme Prediction     

No EC number prediction in MGYG000001039_01938.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	7.7e-111	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.31e-101	1	379	2	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.52e-94	1	376	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	5.78e-69	4	367	2	368	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.32e-58	5	373	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	7.18e-46	1	327	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO23865.1	1.64e-204	1	378	1	378
ADY36062.1	9.26e-203	1	378	1	378
QQY38221.1	3.75e-187	1	376	1	379
ABR39591.1	3.75e-187	1	376	1	379
QUT59470.1	7.56e-187	1	376	1	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.01e-34	5	375	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.01e-34	5	375	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	5.94e-65	5	376	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q6ALW0	2.35e-61	5	374	14	386	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q1D393	4.29e-61	5	374	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q39T49	6.20e-61	5	378	11	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	6.74e-60	5	377	11	383	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001039_01938.