CAZyme Information: MGYG000001036_00893

Basic Information

• Species: CAG-1031 sp900752535
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-1031; CAG-1031 sp900752535
• CAZyme ID: MGYG000001036_00893
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	MGYG000001036_166|CGC1	73528.11	4.9667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001036	3018511	MAG	Sweden	Europe

• Gene Location: Start: 67; End: 2058 Strand: +

Full Sequence      

MKTMGIPCIYGLDQNHGTTYTLGGILFPQNINLGAALNPSLAFQAAEVTAYETRAGNCPW
TYSPTVDMARDPRWPRVWENYGEDPLVNSVMGAHAVRGFQGPDPNHIGPKHVATSTKHYM
GYGFPRTGKDRTPAYISPSDLREKAFAPFKACVDAGTLTIMVNSASINGYPVHADYELLT
VWLKEQLNWDGMIVTDWADINNLFTREKVAKDRKEAIKIAINAGIDMTMDPYDPTFCDLL
KELVNEGEVKMSRIDDATRRILRLKYRLGLFDRPDTYYKDYPEFDSARSRAIALQAAEES
EILLKNVDGILPLDPSRKQKILVTGPNANSMRCLNGGWSYSWQGHVADRFAGEYNTIYEA
LANKFGADNVILEQGVTYVPESAYDAENAPEIEKAVAAAAGADIIVACVGENSYCETPGN
LNDLNISENQSNLVKALAATGKPIILILNEGRPRLIREIEPLAKAIVNVLLPGNFGGDAL
ANILAGDANPSARMPYTYPRYSAALTNYDYRVSEESDTMEGIYDYNAVVSVQWPFGFGLS
YTTFEYSNLRCDKSDFTHNDKLTFTVDLKNTGARTGKESVMLFSRDMVASMVPENRVLRA
FDKVELKPGETKTVSLTIPASDLAFVARDGHWVIEKGEFRMQVGNQAVTITCTDDYRWAN
PNK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	3	229	4.7e-61	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.81e-121	4	644	102	751	beta-glucosidase BglX.
COG1472	BglX	1.69e-74	5	363	59	393	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.60e-57	5	264	65	316	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	8.21e-55	4	645	79	770	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.56e-38	302	541	2	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP73789.1	0.0	1	663	108	768
QCD39173.1	0.0	1	663	108	768
ANU62500.2	0.0	1	663	108	768
QQR10383.1	0.0	1	663	108	768
ASB39022.1	0.0	1	663	108	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	4.39e-312	1	663	97	759	Bacteroidesovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
6R5I_A	4.44e-98	6	644	72	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	2.38e-97	6	644	72	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5R_A	2.44e-97	6	644	73	720	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	4.91e-97	6	644	104	751	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXU3	3.95e-311	1	663	119	781	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q23892	2.09e-142	6	650	169	818	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
P33363	3.11e-100	1	650	99	757	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	4.58e-99	1	650	99	757	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	1.93e-97	2	644	61	707	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999996	0.000054	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001036_00893.