CAZyme Information: MGYG000001034_00072

Basic Information

• Species: Prevotella sp900554695
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900554695
• CAZyme ID: MGYG000001034_00072
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678	MGYG000001034_5|CGC1	76992.06	5.8066

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001034	3004037	MAG	Sweden	Europe

• Gene Location: Start: 47731; End: 49767 Strand: -

Full Sequence      

MIKLKYQLVSLLLFLSSGAVGAQTIRVVDRPDNTSQSNNYVNSRAPLRQQSFIKLPVGSI
HPTGWVGRYLELQRDGLTGHLGEISAWLDKENNAWLTSGGDHGWEEVPYWLKGYSDLAYI
LGDKKMLKETKLWIEAILNSQRPDGSFGPVNMHDDKPELWAQMIALSTLQTYYEYSGDER
VIKLMTDYFKWQLTIPDDKFLEDYWENSRGGDNLYTVLWLYNRTGDKFLLDLAHKIHRNT
ADWCQPTSLPNWHNVNIAECFREPATYYMLTGDKAMLHASYNVQHLIRRTFGQVPGGMFG
SDENARLGYIDPRQGVETCGMVEQMASDEIMLRFTGDPYWAENCEDVAFNTYPAAVMPDF
RSLRYITSPNMVQSDSENHSPGIANSGPFLSMNPFSSRCCQHNHSQGWPYYSENLVYATP
DNGMAFVMYAACTADVKVADNKKVTVTETTNYPFDENITITIDKGKAEFPLYLRIPTWTK
NAEVYVNGEKQTVAPVSGKYYCISREWKKGDSVSLRVPMSLSMRRWQVNKNSVSVDYGPL
TLSLKIKERYVNRDSKETAIHDSQWQKNADASQWPTTEIYADSPWNYALYLNPANALGDI
EVVKKPWPADNFPFTLESVPLEFKAKGRQVPSWTLDATKLCGVLPDECAPKAVTLDDITL
VPMGAARLRISAFPTTDK

Enzyme Prediction     

No EC number prediction in MGYG000001034_00072.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	181	542	3.2e-34	0.6978131212723658

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.73e-127	25	543	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.55e-21	103	567	57	550	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07678	A2M_comp	0.001	50	148	20	134	A-macroglobulin complement component. This family includes the complement components region of the alpha-2-macroglobulin family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO72059.1	5.34e-166	15	676	8	652
QNQ38172.1	1.89e-165	35	675	39	666
QKW18167.1	9.31e-165	40	676	51	670
QYA92533.1	4.20e-164	35	675	39	666
ADJ45365.1	6.20e-164	40	675	44	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	2.75e-15	106	590	78	613	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	9.01e-14	69	543	76	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	1.01e-13	272	590	284	613	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5OPJ_A	4.26e-12	314	543	334	560	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	8.51e-12	220	540	202	542	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002219	0.995905	0.001087	0.000307	0.000239	0.000221

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001034_00072.