CAZyme Information: MGYG000001033_01305

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390
• CAZyme ID: MGYG000001033_01305
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294	MGYG000001033_456|CGC1	33393.87	6.2233

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001033	2187204	MAG	Sweden	Europe

• Gene Location: Start: 7540; End: 8424 Strand: -

Full Sequence      

MIREYPRNLRWAVDYDCFRPQNILIGNCKNVTLRDFHCERSGFWNIHLYYSSDILVDHVT
ISRNMGPSTDGIDIDSCNRVTVKGCHISCHDDAIVIKSGRDADGLRVNRICQNIEIFDCH
LTAPSEGITLGSDMSGGIKSVYIHDCTFRGSPFGFRIKSARTRGGTIQDVRVENLKMYDV
REPFSFQLNWFPEFSYCKIPEDYTGEIPEHWRILSQYVPPEIGLPTLKDICIENVSSYTD
ASGTDRAPLIFSIDTDPHRPIENLLFRNLEVSAPTFGSIASVKGLRFENVKISV

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	14	277	2.1e-57	0.6676923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.39e-37	19	186	237	404	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.12e-17	20	180	85	239	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN02188	PLN02188	5.64e-12	13	197	147	326	polygalacturonase/glycoside hydrolase family protein
PLN02218	PLN02218	2.29e-11	20	183	192	348	polygalacturonase ADPG
PLN03003	PLN03003	5.06e-11	19	183	137	294	Probable polygalacturonase At3g15720

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANX00772.1	6.66e-90	1	292	131	428
ANW98240.1	9.41e-90	1	292	131	428
AGC67830.1	9.41e-90	1	292	131	428
AGI38870.1	9.41e-90	1	292	131	428
AOP83250.1	1.19e-84	1	293	128	416

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	6.10e-29	12	175	192	355	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	3.11e-22	19	170	189	341	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
1BHE_A	1.30e-08	20	183	151	307	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	7.25e-21	19	184	198	365	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	1.07e-16	27	235	29	230	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P18192	1.31e-08	20	183	177	333	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
P35336	1.45e-08	18	198	217	382	Polygalacturonase OS=Actinidia deliciosa OX=3627 PE=2 SV=1
P26509	7.53e-08	20	183	177	333	Endo-polygalacturonase OS=Pectobacterium parmentieri OX=1905730 GN=pehA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001033_01305.