CAZyme Information: MGYG000001029_01736

Basic Information

• Species: CAG-217 sp000436335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-217; CAG-217 sp000436335
• CAZyme ID: MGYG000001029_01736
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784	MGYG000001029_18|CGC1	89485.04	5.5764

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001029	1961725	MAG	Sweden	Europe

• Gene Location: Start: 25509; End: 27863 Strand: -

Full Sequence      

MFRLKSNALQREFKVNEGYLYASRIRNTRSGMDLVPDGNSTEFTFHFTDGTEFSSKGLKV
TDSAERDGKLVFTFEEFEGITVTMRYWVGRDGNTLKKQLQFIQATEDKVIDYIALEHIGV
INSQTHFSIPDDVETSMQIPDAMAILGQPFYIDSLFFGCEFPATDNRIQYGIGQVKYYVG
HPVHGRFTCPATVMGGATGNTMAEVQGAFFDYIEYISTKSDFRVQYNSWYDHMLDIDADN
IERSFYEIEQGLSDHGVPPLDAYVIDDGWNNYKAPFWSFNKKFPNKLTDATDQCHKLGST
FGLWLGPRGGYTAATPRFAKKIEKGGNGYLNSNSMDICVGSEKYLQNLEKFLTDTCTEFD
IQYLKLDGFCLKPCTNPKHDHITGGENDMYFVTEMWQRWIDLFTRLRESRAKDNKPLWIN
MTCYVNPSPWWLQYVNSVWLQNSMDIGFAKNLEQQAQVDAEITYRDSMYYDFMCTRALQF
PAKNIYNHEPIYGNTAKVEYTDEEFEKFLFWNACRGQAFNELYLSYNKMNSAKWRILARM
LRWQKANHHILKNAMLLGGDPAENNIYAYAAWTKAGEGIIALRNPTDEKTDLTLTLNKLM
GCPENLRAVKCYNVYNTTGADSLDLFSYGDKMQITLAPFEIKIFQFGDRDNRCLAPENTN
DFTLSFTVSSNADANICRGKDAAIWIANGVLYGTFGGCKIQASLEDGAHYITFVRYKNKM
VRLFMDRQLVDSAYAPEAGPQIATDDLASSAANFSVADGSTPFEELMDLKAVLSGSRKFK
RKRK

Enzyme Prediction     

No EC number prediction in MGYG000001029_01736.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.13e-11	224	307	4	87	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.77e-06	187	307	2	126	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	1.61e-04	226	446	5	181	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	4.30e-04	225	334	4	105	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	0.005	224	307	294	377	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT26415.1	3.11e-154	9	671	43	751
QDO70357.1	7.89e-149	9	719	43	790
ATD48595.1	8.08e-148	55	652	294	921
AZU64122.1	1.41e-147	17	664	259	931
AMN35790.1	2.17e-147	51	652	283	921

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001029_01736.