CAZyme Information: MGYG000001024_00993

Basic Information

• Species: HGM11521 sp900751885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Monoglobales_A; UBA1381; HGM11521; HGM11521 sp900751885
• CAZyme ID: MGYG000001024_00993
• CAZy Family: GT39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
594	MGYG000001024_45|CGC1	68128.81	9.1583

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001024	2614111	MAG	Sweden	Europe

• Gene Location: Start: 60355; End: 62139 Strand: +

Full Sequence      

MKPVKKKRYSFQKTSTEGKPTRFDWIAIAIIMVVYSCIALFHLGGFEAPQSAYTTTNSPT
NMVFDLGSETSISKIKFYLGTPELNESRSLSFDFSDQADSGFTNLQSVNRGNVFAWNDVP
VEVTARYVRVKTNGNQIMLNEISIINAEGNVVTPQNASEFAALFDEQAMTPDRISLENST
YFDEIYHARTGYELLHGLPVYEWTHPPLGKIFISLGIAIFGMVPFGWRIVGTIFGILMIP
AIYLFAKRLFKHSWLAVVTCLLFTFDFMHFVQTRIATIDVYVTFFIILMYYFMYKYYTMS
FYDTPLRKTLVPLALSGLCMGLGIASKWTGVYAGCGLAVLFFLTLFRRFREYSYAKTKPR
GQTDGIQHEAVIQSFQSNTIKTLLWCCLFFIVVPIIIYLLAYIPYVRCTGGGFASILKNQ
ADMLTYHSKTVLTSTHPFSSHWYEWPIMRRPIWYYSSAVSNTVKEGISAFGNPLVWWLGI
AAFVYMIYLAIAKKDKTALFLIIAYLAQLVSWIPVTRITFIYHYFPCVPFIVLMLGHSIY
RLYQANHNYKYAAFVYAGLVVVLFAFFYPVLSGLPMNVEFVKTWMEWFPTWILI

Enzyme Prediction     

No EC number prediction in MGYG000001024_00993.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	173	405	4.9e-58	0.9372197309417041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16192	PMT_4TMC	5.00e-25	423	589	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1928	PMT1	6.81e-18	173	402	41	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	9.61e-17	427	594	510	696	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam13231	PMT_2	3.56e-14	205	348	2	136	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	9.97e-14	173	349	14	204	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCN30459.1	1.72e-203	6	594	473	1059
BBF42044.1	1.91e-189	2	594	328	921
QNM01664.1	2.73e-180	21	594	482	1086
AIQ72362.1	1.54e-153	22	592	5	591
AIQ66842.1	2.67e-150	14	592	435	1030

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WN04	1.83e-23	182	591	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.83e-23	182	591	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	2.44e-20	204	591	98	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
L8F4Z2	1.31e-18	182	591	67	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000002	0.000023	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	43
224	246
253	270
275	294
306	325
329	346
383	405
474	491
498	515
520	539
552	574