CAZyme Information: MGYG000001021_00687

Basic Information

• Species: Ruminococcus_C sp000980705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_C; Ruminococcus_C sp000980705
• CAZyme ID: MGYG000001021_00687
• CAZy Family: PL11
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1131	MGYG000001021_11|CGC3	120923.09	4.4042

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001021	2360136	MAG	Sweden	Europe

• Gene Location: Start: 149528; End: 152923 Strand: -

Full Sequence      

MKKKLTAWITAAAMGLSMLGTVVPQAALAASAAGSIQVEHLDRGISAINTSSGMLVSWRF
LANDSDSAVFQLYRNNTLVYTSSAGESTCYLDKDGKSTDKYRVDTLEGGKVVSSADCTMI
SNQNYFQLNLDPPTGSGCTYSPNDCSVGDADGDGMYEIFMKWDPSNSKDNSQKGKTGNVF
IDCYRLDGTRLWRIDLGKNIRAGAHYTQFFVADFDCDGKAEMTCKTADGTVDGKGTVIGD
ASKDYRNSNGYVLSGPEYYTLFDGSTGAALDTINYEPGRGTVSKWGDSYGNRVDRFWGTV
AYLDGSKPSVVTGRGYYTRMTATAYDVVNKKLVKRWAFDTGNDKSAAGYGDGNHNSMAAD
VDGDGKQEIITGSTCIDDNGKVLWCLNKGHGDALHLGDFLPNRKGQELWICHEDKPYGVS
LVDASNGKIIFHKDGTGDTGRCCADNVWAGNDGAEFWGLNNDVFDGSGNTLSCRRPAINF
LSYWDGDLEREILDGSTDSPATISKMGTDGKLTTLLSTDGYYTCNTTKGTPCLSADIFGD
WREELIVRAADSKSIRIYCTPYDTDYRITTLMHDPQYRVQVSAQQTAYNQPPHASFYLGS
DQPLPARPNVTVLGQTTPTPTPTPDPEPVTPTAAVLPEGAVFMLKNVNSGLYLEVANGSA
EAGANLQQWGADGAAAHNTWRAVSAGDGYYYLYSQVGDKITYLMDISGGKADNGTNAALW
TKSSREQAQQFLFAKNSDGSYTIYTRASELKSCVEVADASTASGANVQQYAYNGNACQHW
NLEEVADTGVKLDTTKVYQFQNSNSGLMLEVANASTEAGANVQQYAENGNNCQKWTLKEF
GDGYYYILSQLSDGKTYYLDVADGKSDDGTNIQIFTNNKSSTQLFKFIPNPDGTYYIVTR
ATRDKGGLGVSGASTNNGANVIQWTKNGNADQKWIVTAIGDITAPVTTTEPPATTLPTET
TTSAAPTETTAAPTETTTSAAPTETTAAPTETTTSAAPTETTAAPTETTTSAAPVTVTET
VPTETTSETPAETSLATTVTTTTTAAPASSDTTTSTTKAAPVSSILYGDTSMDGRVDITD
AVLLNKAIAGAVELDTNARQNGDCKQDGELTLEDAVTLLQFLVHVISSLPQ

Enzyme Prediction     

No EC number prediction in MGYG000001021_00687.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL11	36	617	4.3e-244	0.9653465346534653
CBM13	795	940	2.2e-26	0.7074468085106383
CBM13	641	787	2.4e-20	0.7021276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10318	RGL11	0.0	38	596	1	564	Rhamnogalacturonan lyase of the polysaccharide lyase family 11. The rhamnogalacturonan lyase of the polysaccharide lyase family 11 (RGL11) cleaves glycoside bonds in polygalacturonan as well as RG (rhamnogalacturonan) type-I through a beta-elimination reaction. Functionally characterized members of this family, YesW and YesX from Bacillus subtilis, cleave glycoside bonds between rhamnose and galacturonic acid residues in the RG-I region of plant cell wall pectin. YesW and YesX work synergistically, with YesW cleaving the glycoside bond of the RG chain endolytically, and YesX converting the resultant oligosaccharides through an exotype reaction. This domain is sometimes found in architectures with non-catalytic carbohydrate-binding modules (CBMs). There are two types of RG lyases, which both cleave the alpha-1,4 bonds of the RG-I main chain through a beta-elimination reaction, but belong to two structurally unrelated polysaccharide lyase (PL) families, 4 and 11.
pfam18370	RGI_lyase	2.93e-26	37	120	2	85	Rhamnogalacturonan I lyases beta-sheet domain. This is the beta-sheet domain found in rhamnogalacturonan (RG) lyases, which are responsible for an initial cleavage of the RG type I (RG-I) region of plant cell wall pectin. Polysaccharide lyase family 11 carrying this domain, such as YesW (EC:4.2.2.23) and YesX (EC:4.2.2.24), cleave glycoside bonds between rhamnose and galacturonic acid residues in RG-I through a beta-elimination reaction. Other family members carrying this domain are hemagglutinin A, lysine gingipain (Kgp) and Chitinase C (EC:3.2.1.14).
pfam14200	RicinB_lectin_2	1.19e-23	776	875	1	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	1.09e-20	728	825	2	89	Ricin-type beta-trefoil lectin domain-like.
pfam14200	RicinB_lectin_2	2.06e-18	831	924	1	89	Ricin-type beta-trefoil lectin domain-like.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL16296.1	0.0	3	787	2	773
ADU23014.1	1.01e-267	9	859	16	872
ADU21778.1	5.52e-234	9	618	8	622
QEH66923.1	6.74e-227	9	788	14	783
ADZ85364.1	1.59e-225	9	788	14	783

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CAG_A	1.80e-183	31	610	4	587	Bacilluslicheniformis Rhamnogalacturonan Lyase PL11 [Bacillus licheniformis]
2ZUY_A	2.85e-183	37	614	7	605	Crystalstructure of exotype rhamnogalacturonan lyase YesX [Bacillus subtilis]
2Z8R_A	9.68e-178	37	610	4	580	Crystalstructure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8R_B Crystal structure of rhamnogalacturonan lyase YesW at 1.40 A resolution [Bacillus subtilis],2Z8S_A Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2Z8S_B Crystal structure of rhamnogalacturonan lyase YesW complexed with digalacturonic acid [Bacillus subtilis],2ZUX_A Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis],2ZUX_B Crystal structure of rhamnogalacturonan lyase YesW complexed with rhamnose [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31527	1.20e-182	37	614	7	605	Rhamnogalacturonan exolyase YesX OS=Bacillus subtilis (strain 168) OX=224308 GN=yesX PE=1 SV=1
O31526	1.39e-176	37	610	41	617	Rhamnogalacturonan endolyase YesW OS=Bacillus subtilis (strain 168) OX=224308 GN=yesW PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000331	0.998853	0.000185	0.000239	0.000196	0.000174

TMHMM  Annotations     

start	end
7	29