CAZyme Information: MGYG000000997_01839

Basic Information

• Species: Roseburia sp900548205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900548205
• CAZyme ID: MGYG000000997_01839
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648	MGYG000000997_66|CGC1	73742.37	6.7727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000997	2319952	MAG	China	Asia

• Gene Location: Start: 11425; End: 13371 Strand: -

Full Sequence      

MKITISNIKKGMRYLRHYGMKEFLIRLQEKKEAERVPYEPWYENHKATEAELLRQRKESG
RWKDAPRISIVVPLYCTKEDFLRQMIASVQAQSYENWQLCLADASPAEADGSTQTGRVVG
EYRQSDGRIVYQALQENRGIAENTNAAIELSDGDWIAFMDHDDLLAPDALYEAAALMRRG
PKRQSAVECAGLLQPQKENGSYELIYTDEDKVDMEGRAHFEPHFKPDFNLDLLRSNNYIT
HFTMVSRALFLRVGGLRGEFDGAQDYDFILRCIEATEAVGHVPRILYHWRCHQESTASNP
FSKQYAVEAGRRAIAQHLERVGVPAEVAATKDMGFYTVRYLHRDEPLVSIIIPSKDETQA
LGKCLAAIERSSYQNYEVIVVENNSCEETFSYYRRLAPKCTQREGTVFYEGRLSGGQRLR
IAVWREKFHYSRLNNFGESFAEGEYLVLMNNDIEMITRAWIEELLGTCQRAEVGAVGAKL
YYPDNTVQHAGIVVGIGGSARGIGQNMFAGLSRARSGYLHKASLTMDYSAVTAACMMVKR
DVYEKVGGFADALAVAFNDVDFCLKVRALGLLVVYQPRVEAYHYESKSRGSEDTPEKVAR
FQREIEYMRETWIGILKNGDPYYNPNFSPYVSDYGLRDNRGKNKSGGR

Enzyme Prediction     

No EC number prediction in MGYG000000997_01839.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	69	250	4.2e-22	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.27e-94	66	291	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	4.20e-31	350	585	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.09e-23	69	250	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	8.47e-23	345	591	2	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	4.14e-20	70	182	1	107	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEN97496.1	0.0	1	638	14	646
CBL08069.1	0.0	2	639	7	645
CBL12630.1	3.13e-317	2	639	7	645
VCV23340.1	4.62e-317	2	639	19	657
CBL21583.1	4.04e-235	2	647	18	619

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.41e-127	61	640	361	901	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.83e-93	50	637	303	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	1.09e-09	64	304	6	226	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q48214	3.65e-09	68	274	2	183	Uncharacterized glycosyltransferase HI_1696 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1696 PE=3 SV=2
P71057	9.34e-09	64	295	2	217	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000997_01839.