CAZyme Information: MGYG000000997_00998

Basic Information

• Species: Roseburia sp900548205
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900548205
• CAZyme ID: MGYG000000997_00998
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000000997_23|CGC1	45306.48	5.4469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000997	2319952	MAG	China	Asia

• Gene Location: Start: 5467; End: 6672 Strand: +

Full Sequence      

METIKIGYVGLGCRGTWLLKDVVLAQGEEVVAVCDVYEDRAKEGAKLVAEAGQKEPKIYT
DYRQLLLNSEVTVVIIATAWEYHSEIAIAAMRAGKAVAMEVGGAYTLEQCHELVKAYEET
GMPFMFLENCCFGRREMMALHMAQNGFFGEVVHCSGGYHHDLRDEIADGRENRHYRLRNY
LSHNCDNYPTHELGPIAKILKINHGNRMMTLTSMASKASGLQTYIKEKKADDAFFKDKTF
AQGDVVTTVIKCANGETIVLTLDTTLPRYYSRGFTVRGTKAMYEEATDSVFVDCKEHKAH
DYDWRKECINNASEYEEVYDHPVWKEYIKEGVQGSHDGMDWLEFKKFFEALRADAPMPVD
VYDAASWMAITVLSEMSIAKGGAVVDIPDFTNGKWHRNIAD

Enzyme Prediction     

No EC number prediction in MGYG000000997_00998.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	397	1.2e-146	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	3.10e-20	1	384	1	338	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	6.71e-14	4	125	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
COG4091	COG4091	8.20e-06	4	99	18	131	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].
pfam03447	NAD_binding_3	0.002	10	121	1	110	Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.
COG0460	ThrA	0.004	1	126	1	137	Homoserine dehydrogenase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO31207.1	2.07e-175	1	397	1	397
QIB57148.1	3.26e-169	1	395	1	389
QMW80076.1	3.26e-169	1	395	1	389
QBE96673.1	1.32e-168	1	395	1	389
ALS29040.1	2.31e-161	2	395	3	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	4.43e-97	2	395	19	431	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.96e-63	4	399	43	442	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	5.86e-12	3	121	23	138	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3E18_A	6.05e-08	1	159	3	154	CRYSTALSTRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua],3E18_B CRYSTAL STRUCTURE OF NAD-BINDING PROTEIN FROM Listeria innocua [Listeria innocua]
3I23_A	5.77e-07	3	151	2	146	CrystalStructure of an Oxidoreductase (Gfo/Idh/MocA family) from Enterococcus faecalis. Northeast Structural Genomics Consortium target id EfR167 [Enterococcus faecalis],3I23_B Crystal Structure of an Oxidoreductase (Gfo/Idh/MocA family) from Enterococcus faecalis. Northeast Structural Genomics Consortium target id EfR167 [Enterococcus faecalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8G1	1.55e-97	4	400	53	465	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4Q8F7	2.42e-96	2	395	19	431	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.63e-93	4	397	34	443	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	4.07e-91	4	397	50	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
Q01S58	1.02e-77	3	395	42	432	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000997_00998.