CAZyme Information: MGYG000000991_01028

Basic Information

• Species: UMGS680 sp900544525
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UMGS680; UMGS680 sp900544525
• CAZyme ID: MGYG000000991_01028
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
978	MGYG000000991_48|CGC1	115396.83	8.5886

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000991	3278188	MAG	Denmark	Europe

• Gene Location: Start: 58; End: 2994 Strand: +

Full Sequence      

MSEYKVSIIVPVYNVEAYLPECMESLVHQTLEEIEIIAVNDGSPDNSIDILNRYAKEYPN
KVKVFTTENHGVSHARNFGLDQAQGEYILFVDSDDYLELNMCEILYTKAITDGNDYVLCA
RNNVYENPDGSITKKMAATLPISQNFKLSDRKFELVKISPFPWDKMFKRSLLEGIRFPEG
LRFEDLVVAFSVACKAQCIGKVNLPLYNYRRTTQGGFLNSFNKATMDIVTAFELLFQIMK
KENLFDTFYDELEYICVRHFFFRYPAFFSPSSKGQLDLKLEMIQKTQDFLDKEVPTWREN
HYLKYSSTKSIKNNLELYTNRELLIQKVTEEETASPFSKKVKTVRKKFKSFKAKITGKWK
KFKKSKKKKQLIINKLKFLKLFNLPSTYRYTKYYETCPVEDKTILFESKHGDDMAGNIFN
MMLETKREEYKDFKIYFVLKNAKREFYEKQMAYYGINHVRIIELRSDEYLKVLATAKYLV
TDTSFPPYFIKRPEQVYLNTWHGTPLKAMGRIVPSREYGLGNVQRNFLIADYLLYQQEFS
RDIFLTDYMIDKIYKGNVLLSGYPRNSAFFREHRYEEIRKECGLEGKQVIVYMPTWRGLL
HKMENKLQVKQLYDYFAQLDHVLRDDQVFFVKLHPYVKNGIDCSEFLHIKDFPSEYETYD
FLNASDMLVTDYSSIMFDYGVSKKKIILFTYDRKEYLEGRGIYVDLDEMDLPKAETVEEL
IEAINQDAPFYTNFYERFCSHDTAHTAKDVCDTVFLQKDTGLLIEEHTGETVPNVLIYAK
GLKERYADQHFIRVLNRQNLDERNYFFSFKAAAMKKTSSMLSQLDRKIGYFPLLKERDCL
VSEKIAFKLYLQYGLFKGFYEKKVETFATREVKKDYGDISFDTTILYSCMDRLMFEILSK
TGKKKIFCFSNFNEQKYQNSKRYRKSIQYFLEHTRSFHKVWIPASMENLPEVQELKKYTS
VGVGADTLSITTILKEVH

Enzyme Prediction     

No EC number prediction in MGYG000000991_01028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	7	137	1.5e-34	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	6.90e-79	398	756	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	8.59e-50	376	755	1	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
PRK10073	PRK10073	2.17e-39	2	210	4	216	putative glycosyl transferase; Provisional
pfam00535	Glycos_transf_2	8.59e-36	7	172	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	1.99e-32	8	125	1	119	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHQ61047.1	0.0	1	977	1	978
BCJ93365.1	0.0	1	977	1	979
BCK00831.1	0.0	1	976	1	978
ABX40684.1	0.0	11	931	2	921
BCJ94554.1	1.62e-122	399	888	33	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	1.23e-45	5	754	3	714	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	9.45e-45	5	754	3	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	2.26e-44	5	754	3	714	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
5HEA_A	2.62e-34	6	215	7	221	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	2.50e-27	5	210	6	225	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HLM5	6.24e-45	5	754	3	714	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKI5	3.41e-36	398	752	28	390	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P13485	4.06e-35	361	755	338	743	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
P71057	5.76e-33	1	259	1	261	Putative glycosyltransferase EpsH OS=Bacillus subtilis (strain 168) OX=224308 GN=epsH PE=2 SV=1
Q2G1C1	5.77e-33	390	755	15	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000991_01028.