CAZyme Information: MGYG000000989_00944

Basic Information

• Species: Niameybacter sp900549765
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Cellulosilyticaceae; Niameybacter; Niameybacter sp900549765
• CAZyme ID: MGYG000000989_00944
• CAZy Family: GH94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870	MGYG000000989_15|CGC1	99157.06	4.8015

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000989	3436851	MAG	Denmark	Europe

• Gene Location: Start: 17283; End: 19895 Strand: +

Full Sequence      

MSFFNRVNEYANEYHTLKSNETLAKEKEMPGKAFFIKNNNILAIPREDGDCRYPFGQNGF
NYWVYASGYIHSNEGLFSPYLRASEGQEPKIAFFAGFKGKEGYKVIPILSVPVMDEQVQT
ERYTVFTKASAYYVTEAEGITFAIRTFVDADKKMYYTVSATNNTEEKKEFFVSSYFNPFL
KNAVMEGAENRWFRQATVMPKNEGQNLNNFLIEVYEERDRGAMAPNYGVFTRHLTLSEGA
ELVASEETTSRNDYVGGVRSSLHTPASLYKGTFGDTKKVATFTEVSVAADMLHLILEKGA
SMREDIVMTYCFEDEDMEVAIKGVSTPEVIDEAEEAIIRAEAMHGENMKAVFGKRLSGEI
KEEVFNAFFEHLKKQVEFCSVIKGYIQLSSFSLIGIRDVFQALEGLVFYEPEVAREKMLE
ALNFVQPDGRCPRQYSLPRFEGDTPNMDLRPFIDQGVWVISTIATYLRFTQDFNFLNETC
GYYDFVNDKAHLAKKSDKTSSVLDHLFDIMNYLLTNRDHDYTKCVCALYGDWNDALDGLG
VSKRKDREYGTGVSVMATLQVYQNCHEMIELLEILDAEKYAEKIAEYKQAMTEIEEGLVK
YAIIENEEGEKRLVHGWGDERSYFVGSFDDPDHESRDGITSNAFWVLAGMYDKDMSIKDT
ILGAYDRLGSKYGLKTFEPHFEKGTPGVGRIPNLPKGTAENGAAYIHASTFGVMSLFRMG
ETERAWEELSKCLPFTHEKVSVSPYVMPNSYGYNEEKQIDGESMQDWQTGSSNVVLKTFI
RFVFGVEPQYKGLWIQPSMHIPFATTEFALKVRGTNLVLKYSNNETGKRTFKINGEIQEG
IYDDVMKLKKLWISNEFIVNNKEIVVEILD

Enzyme Prediction     

No EC number prediction in MGYG000000989_00944.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	121	840	1.7e-88	0.63996138996139

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	5.71e-37	112	840	360	1035	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	2.80e-26	375	787	29	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUH28723.1	0.0	7	865	8	866
BCK01764.1	6.11e-304	6	867	6	874
AVM43009.1	2.43e-273	2	870	3	869
AVM43012.1	4.93e-253	1	870	1	875
QDU70466.1	2.30e-223	15	840	43	867

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZLE_A	3.64e-26	397	840	349	766	Cellobionicacid phosphorylase - ligand free structure [Saccharophagus degradans 2-40],4ZLF_A Cellobionic acid phosphorylase - cellobionic acid complex [Saccharophagus degradans 2-40],4ZLG_A Cellobionic acid phosphorylase - gluconic acid complex [Saccharophagus degradans 2-40],4ZLI_A Cellobionic acid phosphorylase - 3-O-beta-D-glucopyranosyl-alpha-D-glucopyranuronic acid complex [Saccharophagus degradans 2-40]
3QDE_A	1.65e-20	395	841	358	780	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3S4C_A	1.52e-19	395	826	365	788	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3RRS_A	4.56e-19	395	826	365	788	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
2CQS_A	2.19e-17	395	824	385	806	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	3.01e-20	394	840	358	794	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q8P3J4	3.20e-18	397	814	362	751	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1
P20471	8.21e-17	248	846	2256	2831	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999846	0.000176	0.000017	0.000001	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000989_00944.